Detailed information of effector


Summary

Effector ID EFF01860 experimental
Effector type Tae
Cognate immunity protein -
Related T6SS (Type) T6SS01243 experimental (Type i5)
Strain Agrobacterium fabrum strain 12D13
Replicon chromosome
Sequence Protein sequence (167 a.a.); Nucleotide sequence (501 bp)
Description Hcp and Tae were detected in the media fraction of each strain while Hcp was not detected in the media fractions of any of the ΔtssL mutants but could be detected in the media fractions of mutant strains complemented with their cognate tssL gene
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ATU_RS20360 (Tae4)
Coordinates (Strand) 1480980..1481480 (+)
NCBI ID 493359403
RefSeq NZ_CP033035
Uniprot ID A0A083ZID4_RHIRD, Q7CUP8_AGRFC
KEGG ID atu:Atu4347
PDB ID 6IJF

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
NnrS PF05940.14 5.4e-45 33..166

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-37 SIIMSGSETVLPQGRSRPKGGIPRGLARTGPVIFSYG
Transmembrane helix 38-60 FRPFFLGGALWAIVAMVLWIAAL
Outside 61-74 SGFIDIGGDYGAPN
Transmembrane helix 75-97 WHAHEMLFGFASAVLAGFLLTAV
Inside 98-103 PNWTGR
Transmembrane helix 104-126 LPVSGKPLVWLFALWCAGRLFLL
Outside 127-129 VPD
Transmembrane helix 130-152 QVGVVIAAAVDGLFLPALLAICA
Inside 153-167 REVIAGRKWKDLKVL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9934 - -



  Protein sequence: 167 a.a.    .

>EFF01860 NZ_CP033035:1480980-1481480 [Agrobacterium fabrum]
SIIMSGSETVLPQGRSRPKGGIPRGLARTGPVIFSYGFRPFFLGGALWAIVAMVLWIAALSGFIDIGGDYGAPNWHAHEM
LFGFASAVLAGFLLTAVPNWTGRLPVSGKPLVWLFALWCAGRLFLLVPDQVGVVIAAAVDGLFLPALLAICAREVIAGRK
WKDLKVL

  Nucleotide sequence: 501 bp    .

>EFF01860 NZ_CP033035:1480980-1481480 [Agrobacterium fabrum]
AGCATTATAATGAGTGGCAGCGAAACCGTTCTCCCCCAAGGGCGCAGCCGGCCAAAGGGCGGCATTCCAAGAGGGCTGGC
GCGCACCGGCCCGGTTATTTTTTCTTACGGCTTCCGGCCGTTTTTCCTCGGCGGCGCCCTCTGGGCCATCGTGGCGATGG
TGTTGTGGATCGCAGCCCTTTCCGGCTTCATCGATATTGGCGGAGACTATGGCGCGCCGAACTGGCATGCCCACGAGATG
CTGTTCGGTTTCGCTTCGGCGGTGCTGGCCGGTTTTCTTTTGACGGCCGTGCCGAACTGGACGGGGCGGCTGCCGGTGTC
GGGCAAACCGCTGGTCTGGCTGTTTGCGCTCTGGTGCGCCGGCCGGCTTTTCCTGCTTGTGCCGGATCAGGTGGGCGTGG
TCATCGCCGCAGCCGTCGACGGGCTGTTCCTGCCGGCGCTGCTGGCGATCTGCGCGCGCGAGGTTATTGCCGGGCGCAAA
TGGAAGGATCTGAAGGTGCTG