Detailed information of effector


Summary

Effector ID EFF01857 experimental
Effector type Tae
Cognate immunity protein -
Related T6SS (Type) T6SS01242 experimental (Type i5)
Strain Agrobacterium tumefaciens strain 1D1108
Replicon chromosome
Sequence Protein sequence (167 a.a.); Nucleotide sequence (501 bp)
Description Hcp and Tae were detected in the media fraction of each strain while Hcp was not detected in the media fractions of any of the ΔtssL mutants but could be detected in the media fractions of mutant strains complemented with their cognate tssL gene
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) At1D1108_RS23245 (Tae4)
Coordinates (Strand) 2064623..2065123 (+)
NCBI ID 503526812
RefSeq NZ_CP032922
Uniprot ID A0A1S7NCB8_9RHIZ, A0A1S7T3J8_RHIRD, F0LDA2_AGRSH
KEGG ID agr:AGROH133_09370
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tae4 PF14113.8 1.1e-18 43..158

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-166 MRVNFDTLYKNYPSSDPSHPNYVSQRDLFTEIGWDDFIGNPNYHNTCAIRVSIAFVKSGINIVPASHRIQKGPYAGKGIEVNMRRLANLVKRTSYLGEPEPFTPATARNGIGARNGVVAFNNIPGYTGGGHIDLVRGGSEATQCASACYYNSETIWFWPLQSSRGS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9791 - -



  Protein sequence: 167 a.a.    .

>EFF01857 NZ_CP032922:2064623-2065123 [Agrobacterium tumefaciens]
MRVNFDTLYKNYPSSDPSHPNYVSQRDLFTEIGWDDFIGNPNYHNTCAIRVSIAFVKSGINIVPASHRIQKGPYAGKGIE
VNMRRLANLVKRTSYLGEPEPFTPATARNGIGARNGVVAFNNIPGYTGGGHIDLVRGGSEATQCASACYYNSETIWFWPL
QSSRGS*

  Nucleotide sequence: 501 bp    .

>EFF01857 NZ_CP032922:2064623-2065123 [Agrobacterium tumefaciens]
ATGCGCGTTAACTTCGACACTCTCTATAAGAATTATCCGAGCAGCGACCCGTCGCACCCGAACTATGTCAGCCAGCGTGA
TCTTTTCACGGAAATCGGCTGGGATGATTTTATCGGTAACCCGAACTATCACAATACCTGTGCCATCCGCGTTAGCATCG
CTTTCGTGAAATCGGGGATCAACATCGTGCCAGCCTCGCATCGCATCCAGAAAGGTCCCTATGCGGGCAAGGGCATTGAG
GTGAACATGCGCCGCCTCGCAAATCTGGTGAAACGGACGAGCTATCTAGGCGAGCCCGAACCGTTTACCCCCGCGACAGC
GCGTAATGGCATCGGTGCCCGTAACGGTGTTGTGGCGTTCAACAATATCCCTGGTTACACCGGAGGCGGCCATATCGATC
TTGTGCGGGGTGGCTCAGAGGCCACCCAATGCGCGTCGGCCTGCTACTACAATTCGGAAACGATCTGGTTCTGGCCACTT
CAGTCCAGCCGCGGGTCCTGA