Detailed information of effector


Summary

Effector ID EFF01854 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01241 experimental (Type i5)
Strain Agrobacterium tumefaciens strain 12D1
Replicon chromosome
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Description Hcp and Tae were detected in the media fraction of each strain while Hcp was not detected in the media fractions of any of the ΔtssL mutants but could be detected in the media fractions of mutant strains complemented with their cognate tssL gene
Reference
[1] Wu CF, Santos MNM, Cho ST, et al. Plant-Pathogenic Agrobacterium tumefaciens Strains Have Diverse Type VI Effector-Immunity Pairs and Vary in In-Planta Competitiveness. Mol Plant Microbe Interact. 2019 Aug;32(8):961-971. doi: 10.1094/MPMI-01-19-0021-R. Epub 2019 Jun 27. PMID: 30830835
[2] Wu CF, Santos MNM, Cho ST, et al. Plant-Pathogenic Agrobacterium tumefaciens Strains Have Diverse Type VI Effector-Immunity Pairs and Vary in In-Planta Competitiveness. Mol Plant Microbe Interact. 2019 Aug;32(8):961-971. doi: 10.1094/MPMI-01-19-0021-R. Epub 2019 Jun 27. PMID: 30830835
[3] Wu CF, Santos MNM, Cho ST, et al. Plant-Pathogenic Agrobacterium tumefaciens Strains Have Diverse Type VI Effector-Immunity Pairs and Vary in In-Planta Competitiveness. Mol Plant Microbe Interact. 2019 Aug;32(8):961-971. doi: 10.1094/MPMI-01-19-0021-R. Epub 2019 Jun 27. PMID: 30830835
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) At12D1_RS23080 (Hcp)
Coordinates (Strand) 1737810..1738286 (+)
NCBI ID 489600119
RefSeq NZ_CP033032
Uniprot ID A0A1S9EUT1_9HYPH, A0A1S7QKJ0_RHIRD, A0A1S7S980_RHIRD, A0A1S7U5K7_9HYPH, A0A1S7QJJ5_9HYPH, A0A1S7REK6_9HYPH, A0A0X6ZNV9_9HYPH, A9CGG8_AGRFC, A0A083ZID2_RHIRD, A0A0X7A9B9_9HYPH
KEGG ID atu:Atu4345
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 8.8e-33 4..133

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-158 MPIYLQIDGIQGDATHEEHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTISEVILTKVSDSSSTKLFQEACAGRTGKLATIHLVTTGNPGNTYIEYLLTNTLIASYSVDSSGDRPVETIKLNFTKMEVKYTPFDDNNSPQSPMIASYDLATTKAA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9890 - -



  Protein sequence: 159 a.a.    .

>EFF01854 NZ_CP033032:1737810-1738286 [Agrobacterium tumefaciens]
MPIYLQIDGIQGDATHEEHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTISEVILTKVSDSSSTKLFQEACAGRTGK
LATIHLVTTGNPGNTYIEYLLTNTLIASYSVDSSGDRPVETIKLNFTKMEVKYTPFDDNNSPQSPMIASYDLATTKAA*

  Nucleotide sequence: 477 bp    .

>EFF01854 NZ_CP033032:1737810-1738286 [Agrobacterium tumefaciens]
ATGCCAATTTATCTGCAGATTGACGGTATCCAGGGCGACGCCACGCATGAGGAGCACCGCAAGTGGATGGACATCGAAGC
CATTCACTGGAACGTGGCACGCAACATGAACACATCTGCTGGTTCTGCTGCAAACCGCGAAGCATCCGAACCGACTATTT
CGGAAGTCATTCTGACCAAGGTCAGCGATTCTTCTTCCACCAAGCTTTTCCAGGAAGCCTGCGCCGGCCGCACTGGCAAG
CTCGCAACCATCCATCTGGTGACCACGGGCAATCCGGGCAACACCTATATCGAGTACCTGCTGACGAACACACTCATCGC
CAGCTACTCGGTGGATTCCAGCGGTGATCGTCCGGTGGAAACCATCAAGCTCAACTTCACCAAAATGGAAGTGAAGTACA
CGCCGTTCGACGACAACAACTCGCCGCAGTCTCCGATGATCGCCTCTTACGATCTGGCGACGACGAAGGCCGCTTGA