Detailed information of effector


Summary

Effector ID EFF01849 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01276 experimental (Type i4b)
Strain Burkholderia cenocepacia strain K56-2 scf7180000000051
Replicon chromosome
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Description hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) WQ49_11820 (hcp)
Coordinates (Strand) 76454..76957 (-)
NCBI ID 493523014
RefSeq NZ_LAUA01000004
Uniprot ID A0A0B1YQS5_9BURK, A0A0U4DCL3_BURCE, A0A084D9C9_9BURK, A0A2S9KZ71_9BURK, A0A1K1S9E0_9BURK, A0A117VGM3_9BURK, A0A1B4F605_9BURK, A0A103LBA0_9BURK, A0A2A4CEA2_9BURK, A0A1X1P7H9_9BURK, A0A2A9LW14_9BURK, A0A228PYE3_9BURK, A0A228HBG8_9BURK, A0A228I0N3_9BURK, A0A228J4P0_9BURK, A0A228K684_9BURK, A0A228RK00_9BURK, A0A228QKE8_9BURK, B4E6R5_BURCJ, A0A2U9SGD4_9BURK, A0A081V0J2_BURCE, A0A0H2XRS0_BURCA, Q0BIT1_BURCM, B1FDD0_9BURK, B1T015_9BURK, B1YS99_BURA4, B1JUN9_BURCC, Q39K54_BURL3, A0A0G3YXS0_9BURK, A0A1B4HQA6_9BURK, A0A1B4BP34_9BURK, A0A087NNS3_BURPY, A0A1D7ZEA5_9BURK, A0A0M1IMJ7_9BURK
KEGG ID bdf:WI26_01920, bstl:BBJ41_12130, bur:Bcep18194_A3561, bam:Bamb_0383, bcon:NL30_20125, bcj:BCAL0343, bpyr:ABD05_07980, bcn:Bcen_2637, bmec:WJ16_01965, bcm:Bcenmc03_0447, bac:BamMC406_0404
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.1e-37 10..138

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-167 MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSPLLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDKTYAV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9447 - -



  Protein sequence: 168 a.a.    .

>EFF01849 NZ_LAUA01000004:c76957-76454 [Burkholderia cenocepacia]
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSPLLYQHASGGT
TFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTK
NDKTYAV*

  Nucleotide sequence: 504 bp    .

>EFF01849 NZ_LAUA01000004:c76957-76454 [Burkholderia cenocepacia]
ATGTTACATATGCACTTGCAGTTTGGTAGTCCCGCGGTGAAGGGCGAATCCGCGGACAAGGACCATCAGGGCTGGATCGA
ACTGAAATCGTGGGATCACTCGATCGTTCAGCCGCGTTCGGCAACCGCATCGACCGCTGGCGGTCACACGATGACGCGTT
GCGAGCACGGCGACATGATCTTCACGAAGGAAATCGATTCGTCGAGCCCGCTGCTGTACCAGCACGCTTCGGGCGGTACC
ACGTTCGACGAAGTGACGGTCCATTTCTCGCGCGCGGACGGTGAAGGCAAGCGCGTGCAGTATCTGGAAGTCAAGCTCAA
ATACGTGATCATCTCGAGCATCGCCCCGAGCGTCCGCGAGGAAGGTCTGCCCCTCGAGACGTTCTCGCTGAAGTACGCAG
CCGTGCAGTGGAAGCAAACCCAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAAGGCGCCTGGAGCCTGACGAAG
AACGACAAGACCTACGCGGTCTAA