Detailed information of effector


Summary

Effector ID EFF01847 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01164 experimental (Type i4b)
Strain Acinetobacter baumannii strain AbCAN2
Replicon chromosome
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Description Hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) F9K57_RS05830
Coordinates (Strand) 1215046..1215549 (+)
NCBI ID 446575849
RefSeq NZ_CP045428
Uniprot ID A0A0R1C1Y7_ACINO, A0A009RJK0_9GAMM, A0A010KAB5_9GAMM, A0A013UTK5_9GAMM, A0A013TMC1_9GAMM, A0A0E1PSF3_ACIBA, A0A0J0ZX19_ACIBA, N8S3X6_9GAMM, A0A1V2V3D7_9GAMM, A0A1A0GM72_ACICA, A0A143IYH8_ACIPI, B0VB03_ACIBY, D0C8P3_ACIB2, F0KJP8_ACICP, L9MI81_9GAMM
KEGG ID aby:ABAYE2413, acc:BDGL_000641
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 5.4e-40 5..139

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-167 MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATSPKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSNNTASYAA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9825 - -



  Protein sequence: 168 a.a.    .

>EFF01847 NZ_CP045428:1215046-1215549 [Acinetobacter baumannii]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATSPKLWEACSAG
YTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSN
NTASYAA*

  Nucleotide sequence: 504 bp    .

>EFF01847 NZ_CP045428:1215046-1215549 [Acinetobacter baumannii]
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACAAAGGTTGGTT
AGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGTAGGCGGCCACACTGCTGAAC
GTGTTGAACATTCTGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGCCCTAAATTATGGGAAGCTTGTTCAGCTGGT
TATACATTTGATGAAGTACAAATCGACTTCTATCGCGCAAATGGTGATAAACGTATCAAGTACTTACAAATCAAATTGAA
GCACGTTCTAGTTTCTAGTGTAACTCCAACTGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTG
CTGTTGAGTGGACTTATAACCAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAAT
AATACAGCTTCTTACGCAGCGTAA