Detailed information of effector


Summary

Effector ID EFF01846 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01103 experimental (Type i5)
Strain Agrobacterium tumefaciens strain 1D1609
Replicon chromosome
Sequence Protein sequence (756 a.a.); Nucleotide sequence (2268 bp)
Description VgrG
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) At1D1609_RS26290
Coordinates (Strand) 2295823..2298090 (+)
NCBI ID 1352522879
RefSeq NZ_CP026925
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 3.7e-73 36..347
Phage_base_V PF04717.14 2.9e-12 401..468

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-755 MNDQPSSSDFIQASRVLKVKSTLGEDQLLPERLTVEEGVSQLFDIRLTVRAKKEAVKPEELIGRLVDVSVEVQQGDGEEGSGVRRPFNGLVTELHEGPPITRGMRSYAMTIRPQMWLLSRRSDCRIWMDKTAVEVVETLFSEHGIPAPDTSGIISPPPAQHYSVQWNETDLDYLTRRFEEDGLFYWFSHEDGSHKLHVADSASGWLGPSPAAQGEGTVRLAQGSSDRNHINDWARRFSYVSGQRAGADWNFETPGMVPGTMTPSLVQMPDATKRELYEYPARIKTVEEAERAQKLRTQSIEADHDRVFGSSTSRILEAGRRFTPYEVAHPEHAYEEHVIIRASHNIVDLSYETNGNEPEYRNHFEAIPARVPLTPHRSTKRPRIEGTQVAIVAGPEGEEIHPDQYGRIKLWFPWDRKAKKDGTDTCWVRVSQAWGGGTWGAQVIPRIGMEVMVAFVDGDPDKPLVIGVVNNPANSVPYDLPANKTRMVLRSNSHKGDGFNEITFEDEAGKENQFFHAQKDQTTRVLNDRTKRIDRHEVASVGGNRAVEVSGNQKHEIGGSVNTVVGGTGPMAMMAMAGVQALSGQTAGLLSQAAQIAGGGGPGVAAFATTLASSALGFLGAGGLSSREGVVSGPSPRADAGTALAGSGSGVGSDASGLFPLPGIMNTIIGSFQSTSVGIAKTEQVGVSKVTNVGQTSMENVGKAKKLTVGEEYVIEVGKSSMTMKKDGTIIIKGVTFHFEAEGSFQQIGKVIDLN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9923 - -



  Protein sequence: 756 a.a.    .

>EFF01846 NZ_CP026925:2295823-2298090 [Agrobacterium tumefaciens]
MNDQPSSSDFIQASRVLKVKSTLGEDQLLPERLTVEEGVSQLFDIRLTVRAKKEAVKPEELIGRLVDVSVEVQQGDGEEG
SGVRRPFNGLVTELHEGPPITRGMRSYAMTIRPQMWLLSRRSDCRIWMDKTAVEVVETLFSEHGIPAPDTSGIISPPPAQ
HYSVQWNETDLDYLTRRFEEDGLFYWFSHEDGSHKLHVADSASGWLGPSPAAQGEGTVRLAQGSSDRNHINDWARRFSYV
SGQRAGADWNFETPGMVPGTMTPSLVQMPDATKRELYEYPARIKTVEEAERAQKLRTQSIEADHDRVFGSSTSRILEAGR
RFTPYEVAHPEHAYEEHVIIRASHNIVDLSYETNGNEPEYRNHFEAIPARVPLTPHRSTKRPRIEGTQVAIVAGPEGEEI
HPDQYGRIKLWFPWDRKAKKDGTDTCWVRVSQAWGGGTWGAQVIPRIGMEVMVAFVDGDPDKPLVIGVVNNPANSVPYDL
PANKTRMVLRSNSHKGDGFNEITFEDEAGKENQFFHAQKDQTTRVLNDRTKRIDRHEVASVGGNRAVEVSGNQKHEIGGS
VNTVVGGTGPMAMMAMAGVQALSGQTAGLLSQAAQIAGGGGPGVAAFATTLASSALGFLGAGGLSSREGVVSGPSPRADA
GTALAGSGSGVGSDASGLFPLPGIMNTIIGSFQSTSVGIAKTEQVGVSKVTNVGQTSMENVGKAKKLTVGEEYVIEVGKS
SMTMKKDGTIIIKGVTFHFEAEGSFQQIGKVIDLN*

  Nucleotide sequence: 2268 bp    .

>EFF01846 NZ_CP026925:2295823-2298090 [Agrobacterium tumefaciens]
ATGAATGACCAGCCCTCATCCTCTGACTTCATTCAGGCGAGTCGTGTGCTCAAGGTCAAGTCGACTTTGGGCGAGGATCA
GCTTCTTCCGGAGCGTCTGACGGTCGAGGAAGGTGTATCGCAACTCTTCGACATCCGCCTGACGGTGCGGGCCAAGAAAG
AAGCGGTCAAGCCCGAAGAACTGATCGGACGGCTGGTCGATGTTTCAGTCGAGGTGCAACAGGGCGATGGCGAAGAGGGC
AGCGGCGTGCGCCGCCCCTTCAACGGCCTGGTTACCGAGTTGCATGAGGGTCCGCCGATCACCCGCGGCATGCGCTCCTA
TGCCATGACCATCCGCCCGCAAATGTGGCTTCTGTCACGCCGGTCCGATTGCCGCATCTGGATGGACAAGACGGCGGTGG
AGGTCGTCGAGACGCTGTTTTCCGAACACGGTATTCCCGCACCCGATACATCGGGCATCATCTCGCCGCCGCCCGCACAG
CATTACAGCGTGCAATGGAACGAGACGGATCTCGATTATCTCACCCGCCGTTTTGAAGAGGACGGCCTGTTCTACTGGTT
CAGCCATGAGGATGGTTCCCACAAGCTGCATGTGGCCGATAGCGCCAGCGGCTGGCTTGGGCCGTCGCCGGCAGCCCAGG
GGGAGGGGACGGTGCGCCTGGCGCAGGGGTCTTCGGACCGTAACCACATCAACGACTGGGCGCGGCGTTTTTCCTATGTT
TCGGGCCAGCGCGCTGGCGCGGACTGGAATTTCGAGACGCCGGGCATGGTGCCGGGCACGATGACACCGTCGCTGGTGCA
GATGCCGGATGCGACGAAGCGCGAGCTTTACGAATATCCGGCCCGCATCAAGACGGTGGAAGAGGCCGAGCGCGCGCAGA
AACTGCGCACCCAGTCCATCGAAGCCGATCACGACCGGGTTTTCGGTTCGTCGACCTCGCGCATTCTGGAGGCCGGCCGC
CGTTTCACGCCTTACGAGGTCGCCCATCCCGAACACGCCTATGAAGAACATGTGATCATCAGGGCAAGCCACAATATTGT
CGATCTCTCTTATGAGACCAATGGCAACGAGCCGGAATATCGCAATCACTTCGAGGCGATCCCCGCCCGTGTGCCGCTGA
CGCCGCACCGGTCAACAAAACGCCCGCGCATCGAAGGGACGCAGGTGGCGATCGTCGCCGGACCTGAGGGCGAGGAAATC
CATCCTGACCAATATGGCCGCATCAAGCTGTGGTTCCCGTGGGACCGCAAGGCGAAGAAGGATGGCACGGATACGTGCTG
GGTTCGTGTCAGCCAGGCATGGGGCGGCGGCACTTGGGGTGCGCAGGTCATTCCGCGCATCGGCATGGAAGTCATGGTCG
CCTTTGTCGATGGCGACCCGGATAAGCCGCTGGTCATCGGCGTGGTCAACAATCCGGCCAATTCCGTGCCTTACGACCTG
CCCGCCAACAAGACACGTATGGTGCTGCGCTCCAACAGCCACAAGGGCGACGGTTTCAACGAAATCACCTTCGAGGATGA
GGCCGGCAAGGAGAACCAGTTCTTCCACGCCCAGAAGGACCAGACGACGCGGGTTCTGAATGACCGGACCAAGCGCATCG
ACCGGCATGAGGTCGCCTCGGTCGGCGGCAACCGCGCGGTGGAAGTTTCCGGCAACCAGAAACACGAGATCGGCGGCTCG
GTAAACACCGTCGTCGGCGGCACGGGACCGATGGCGATGATGGCCATGGCCGGCGTACAGGCGCTCTCCGGGCAGACGGC
GGGCCTGCTTTCGCAGGCCGCCCAGATCGCCGGCGGCGGTGGCCCGGGCGTCGCGGCCTTCGCCACCACGCTCGCCTCAT
CCGCACTCGGCTTCCTCGGAGCCGGCGGTCTTTCATCGCGTGAGGGGGTCGTTTCCGGCCCGAGCCCGCGCGCGGATGCG
GGTACGGCGCTCGCCGGCTCCGGCTCGGGCGTCGGCTCCGATGCTTCAGGTCTCTTTCCGCTACCGGGCATCATGAACAC
GATCATCGGTTCGTTTCAGTCCACATCTGTTGGCATCGCAAAAACCGAGCAGGTCGGGGTCAGCAAGGTCACAAATGTCG
GCCAGACGTCGATGGAAAATGTCGGCAAGGCGAAGAAACTCACTGTGGGAGAGGAATATGTCATCGAAGTCGGCAAGTCG
TCCATGACGATGAAAAAGGACGGCACGATCATCATTAAGGGCGTGACGTTTCATTTCGAGGCTGAAGGTTCGTTTCAGCA
GATCGGCAAAGTCATAGATCTCAACTGA