Detailed information of effector


Summary

Effector ID EFF01842 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01282 experimental (Type i3)
Strain Kosakonia oryzae strain KO348
Replicon chromosome
Sequence Protein sequence (744 a.a.); Nucleotide sequence (2232 bp)
Description VgrG
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) UG97_RS09090
Coordinates (Strand) 162910..165141 (-)
NCBI ID 780193664
RefSeq NZ_JZLI01000006
Uniprot ID UPI0005EF0F9E
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 6.3e-84 22..326
Phage_base_V PF04717.14 1e-14 381..448

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-743 MQNRITATLPVGGLLFWKLAGREALSESFTLALTVLGTDARADRSKLLGQSATINIPTQGTGTRYINGKITRVAVSAVELSGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTAPQIVKTLLGEYQVNVEDKLTGSYRTWDYCVQYQESSLDFISRLMELEGIAYHFRHEADRHVLVLTDAATEHQPFSGYETIPYHQTPSGGSTDEEGISQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPASPQPGSIDVYDWPGRFVEHGHGEYYARIRQERWQVEHQQIQGTATAVGVAPGNTFALYNAPFFSDNGEYLTTEANYFFEENRYASGSDGETVHRIDFTVIPSSVVFRPAAVTAWPKTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGGVQIPRVGDEVVIDFINGDPDRPIVTGRVYNESSMPPWTLPDDSTRMGFMTRSKDGSKDNASYLFFEDRAGSEAVELHSEKDMKVSVENDKTVNIDGNRTTTILKEQKDDVTGDASFYYRAKRTTTVDEAETTTFNNSQTETIKNGRTLNITSGGDVVTVKEGRITEVEGTESHHVTGLVTEKFDSGQMTTIEGGLTVDVNSGNWTQNVNGGTITISSPNMIRISSKEQIVMDAPEAVFKPKFHTLSVTAFSESFVGHSASGTGMTSSATGIALSANGMSIGFKLKDLSKTLFKKEANGVVINYEVTNISNRTLNITNNALYIFT



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.6536 - -



  Protein sequence: 744 a.a.    .

>EFF01842 NZ_JZLI01000006:c165141-162910 [Kosakonia oryzae]
MQNRITATLPVGGLLFWKLAGREALSESFTLALTVLGTDARADRSKLLGQSATINIPTQGTGTRYINGKITRVAVSAVEL
SGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTAPQIVKTLLGEYQVNVEDKLTGSYRTWDYCVQYQESSLDFISRLMELE
GIAYHFRHEADRHVLVLTDAATEHQPFSGYETIPYHQTPSGGSTDEEGISQWALEDSVTPGIYSLDDYDFRKPNAWLFQA
RQNPASPQPGSIDVYDWPGRFVEHGHGEYYARIRQERWQVEHQQIQGTATAVGVAPGNTFALYNAPFFSDNGEYLTTEAN
YFFEENRYASGSDGETVHRIDFTVIPSSVVFRPAAVTAWPKTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLAKGDD
TSSCWVRVSSAWAGQGFGGVQIPRVGDEVVIDFINGDPDRPIVTGRVYNESSMPPWTLPDDSTRMGFMTRSKDGSKDNAS
YLFFEDRAGSEAVELHSEKDMKVSVENDKTVNIDGNRTTTILKEQKDDVTGDASFYYRAKRTTTVDEAETTTFNNSQTET
IKNGRTLNITSGGDVVTVKEGRITEVEGTESHHVTGLVTEKFDSGQMTTIEGGLTVDVNSGNWTQNVNGGTITISSPNMI
RISSKEQIVMDAPEAVFKPKFHTLSVTAFSESFVGHSASGTGMTSSATGIALSANGMSIGFKLKDLSKTLFKKEANGVVI
NYEVTNISNRTLNITNNALYIFT*

  Nucleotide sequence: 2232 bp    .

>EFF01842 NZ_JZLI01000006:c165141-162910 [Kosakonia oryzae]
ATGCAGAACAGAATCACGGCGACGTTACCCGTCGGGGGCTTACTTTTCTGGAAACTTGCCGGGCGCGAAGCGCTGTCCGA
GTCATTTACGCTGGCGCTGACGGTGCTGGGCACCGATGCGCGGGCAGACCGCAGCAAGCTGCTGGGGCAATCCGCAACCA
TCAATATTCCCACCCAGGGAACGGGTACGCGCTATATCAACGGCAAAATCACCCGCGTGGCGGTGAGCGCCGTTGAACTT
TCGGGGACGCGTTACGCGGTGTACCAGCTCACCGTGGAGCCGGATTTGTGGCCGATGAAACGCGACCGCAACCTGCGTAT
CTTCCAGGGCCAGACTGCGCCGCAGATTGTGAAAACGCTGCTCGGCGAATATCAGGTGAACGTGGAAGATAAGCTGACCG
GCAGTTACCGCACCTGGGATTACTGCGTGCAGTACCAGGAATCGAGCCTCGATTTCATCAGCCGTCTGATGGAGCTTGAG
GGCATCGCCTACCATTTCCGCCACGAAGCCGACCGCCATGTGCTGGTGCTGACCGACGCGGCGACCGAACATCAACCCTT
CAGCGGCTACGAAACCATTCCCTATCACCAGACGCCGTCCGGCGGCAGCACGGATGAAGAGGGTATCAGCCAGTGGGCGC
TGGAGGACAGCGTGACGCCGGGTATTTACAGCCTCGACGATTACGACTTCCGCAAGCCGAACGCGTGGCTGTTCCAGGCG
CGGCAGAACCCGGCATCACCGCAGCCGGGCAGCATTGACGTGTATGACTGGCCGGGGCGTTTTGTCGAGCACGGTCACGG
GGAGTATTACGCGCGTATCCGCCAGGAGCGCTGGCAGGTGGAGCACCAGCAGATTCAGGGCACCGCCACGGCGGTTGGTG
TCGCACCGGGAAACACCTTTGCGCTGTATAACGCGCCGTTTTTCAGCGATAACGGCGAGTACCTGACCACCGAAGCGAAC
TACTTTTTCGAGGAAAACCGCTACGCCAGCGGCTCCGACGGCGAAACGGTGCACCGCATTGATTTCACCGTCATTCCGTC
GTCGGTGGTGTTCCGCCCGGCGGCGGTGACGGCGTGGCCGAAAACCTACGGTCCGCAGACGGCGAAAGTGGTCGGCCCGC
AGGGCGAAAGCATCTGGACGGATAAATATGGCCGGGTGAAGGTGAAATTCCACTGGGATCGTCTGGCAAAAGGCGATGAC
ACCAGCTCCTGCTGGGTGCGTGTGTCGAGTGCCTGGGCGGGGCAGGGCTTCGGCGGGGTGCAAATCCCGCGCGTGGGCGA
CGAAGTGGTGATCGACTTTATCAACGGCGACCCGGACCGGCCGATCGTTACCGGGCGTGTCTATAATGAATCCAGCATGC
CGCCGTGGACACTGCCGGATGATTCAACGCGCATGGGCTTTATGACCCGCAGTAAAGACGGCAGCAAAGACAACGCCAGC
TACCTGTTTTTTGAGGATCGCGCCGGGAGTGAAGCTGTTGAGTTGCATTCCGAAAAAGATATGAAAGTCTCGGTGGAAAA
TGACAAGACGGTCAACATTGACGGTAATCGCACGACGACCATTCTGAAAGAGCAGAAAGACGATGTCACCGGCGACGCCT
CGTTTTACTATCGCGCGAAGCGCACGACCACGGTAGATGAAGCGGAAACCACCACCTTCAACAACAGCCAGACGGAAACT
ATCAAGAATGGGCGTACGCTGAATATCACCAGCGGCGGTGATGTTGTGACTGTGAAAGAGGGGCGCATCACTGAGGTGGA
AGGTACTGAGTCACATCACGTTACGGGGCTGGTGACGGAGAAATTTGATAGTGGTCAGATGACGACTATTGAAGGGGGGC
TGACTGTCGATGTTAATAGCGGTAACTGGACGCAAAATGTCAATGGTGGGACGATAACTATCAGTAGCCCTAACATGATA
AGAATTTCCAGCAAAGAGCAAATTGTCATGGATGCACCAGAGGCAGTGTTTAAGCCTAAATTCCATACTCTAAGCGTGAC
GGCATTTAGTGAAAGTTTTGTAGGACATAGCGCATCCGGAACAGGAATGACATCAAGTGCAACGGGGATTGCTTTATCAG
CAAATGGTATGTCTATTGGTTTTAAACTGAAAGATCTTTCTAAGACCCTGTTTAAGAAAGAGGCGAATGGTGTTGTTATA
AACTATGAAGTAACTAATATTAGTAACAGGACGCTAAACATCACCAATAATGCTCTTTATATATTTACTTAG