Detailed information of effector


Summary

Effector ID EFF01841 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01282 experimental (Type i3)
Strain Kosakonia oryzae strain KO348
Replicon chromosome
Sequence Protein sequence (551 a.a.); Nucleotide sequence (1653 bp)
Description hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) UG97_RS00630
Coordinates (Strand) 121734..123386 (-)
NCBI ID 780188092
RefSeq NZ_JZLI01000001
Uniprot ID UPI0005F09F0A
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Prismane PF03063.22 1.7e-153 1..545

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-550 MFCVQCEQTIRTPAGNGCAYAQGMCGKTAETSDLQDLLIAALQGLSAWASKAREYDLIDHEIDNFAPRAFFSTLTNVNFDSVRIVGYAREAIAKREALKARCLAIDPNAHVDNPMADLQLVSDDLGELQRQAAEFTPNKDKAAIGENILGLRLLCLYGLKGAAAYMEHAHVLGQYDNDIYARYHKIMAWLGTWPSDMNALLECSMEIGQMNFSVMSILDAGETSTYGHPTPTQVNVKAVAGKCILISGHDLKDLYNLLQQTEGTGVNVYTHGEMLPAHGYPELRKFKHLVGNYGSGWQNQQVEFARFPGPIVMTSNCIIDPTVGAYDDRIWTRSIVGWPGVNHLEGDDFAPVIRQAQQMSGFPFSEIEHLITVGFGRQTLLGAVDSLIDLVSREKLRHVFLVGGCDGARGERNYFTDFATQVPDDCLILTLACGKYRFNKLDFGNIEGLPRLIDAGQCNDAYSAIILAVTLAEKLGCGVNDLPLSLVLSWFEQKAIVILLTLLSLGVTNIVTGPTAPGFLTPDLLAVLNEKFGLRQVTTVEQDMQQLLSA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9650 - -



  Protein sequence: 551 a.a.    .

>EFF01841 NZ_JZLI01000001:c123386-121734 [Kosakonia oryzae]
MFCVQCEQTIRTPAGNGCAYAQGMCGKTAETSDLQDLLIAALQGLSAWASKAREYDLIDHEIDNFAPRAFFSTLTNVNFD
SVRIVGYAREAIAKREALKARCLAIDPNAHVDNPMADLQLVSDDLGELQRQAAEFTPNKDKAAIGENILGLRLLCLYGLK
GAAAYMEHAHVLGQYDNDIYARYHKIMAWLGTWPSDMNALLECSMEIGQMNFSVMSILDAGETSTYGHPTPTQVNVKAVA
GKCILISGHDLKDLYNLLQQTEGTGVNVYTHGEMLPAHGYPELRKFKHLVGNYGSGWQNQQVEFARFPGPIVMTSNCIID
PTVGAYDDRIWTRSIVGWPGVNHLEGDDFAPVIRQAQQMSGFPFSEIEHLITVGFGRQTLLGAVDSLIDLVSREKLRHVF
LVGGCDGARGERNYFTDFATQVPDDCLILTLACGKYRFNKLDFGNIEGLPRLIDAGQCNDAYSAIILAVTLAEKLGCGVN
DLPLSLVLSWFEQKAIVILLTLLSLGVTNIVTGPTAPGFLTPDLLAVLNEKFGLRQVTTVEQDMQQLLSA*

  Nucleotide sequence: 1653 bp    .

>EFF01841 NZ_JZLI01000001:c123386-121734 [Kosakonia oryzae]
ATGTTTTGTGTGCAATGTGAACAAACCATCCGAACTCCGGCGGGCAACGGCTGTGCGTACGCGCAGGGGATGTGCGGTAA
AACCGCCGAAACCTCCGACCTGCAGGATCTATTGATTGCCGCGTTACAAGGGCTCTCCGCCTGGGCCAGCAAAGCACGTG
AGTACGATCTGATTGACCATGAGATCGATAACTTCGCGCCGCGCGCCTTCTTCTCTACCCTCACCAACGTTAACTTCGAT
TCCGTGCGTATTGTCGGCTACGCGCGCGAGGCAATCGCCAAACGTGAAGCGCTGAAAGCACGCTGCCTCGCTATTGATCC
GAATGCCCACGTCGACAATCCAATGGCCGACCTGCAACTGGTCAGCGACGATCTCGGCGAATTACAGCGCCAGGCGGCAG
AGTTCACGCCGAACAAAGACAAAGCGGCGATTGGCGAAAACATCCTTGGTTTACGCCTGCTCTGCCTGTACGGCCTGAAA
GGCGCGGCGGCCTATATGGAACACGCCCATGTGCTGGGCCAGTACGACAACGATATCTACGCCCGTTATCACAAAATCAT
GGCATGGCTGGGTACCTGGCCTTCTGATATGAATGCCCTGCTCGAATGCTCAATGGAAATTGGCCAGATGAACTTCAGCG
TGATGAGCATTCTGGATGCCGGTGAAACCAGCACTTACGGTCACCCGACGCCTACTCAGGTCAACGTCAAAGCCGTTGCC
GGGAAATGCATCCTGATTTCCGGCCACGACCTGAAAGATCTCTACAACCTGCTGCAACAAACCGAAGGCACGGGCGTAAA
CGTCTATACCCACGGTGAAATGCTACCGGCGCACGGCTACCCGGAACTGCGCAAATTCAAACATCTGGTCGGTAACTACG
GTAGCGGCTGGCAGAACCAGCAGGTGGAATTCGCCCGCTTCCCTGGCCCCATCGTCATGACGTCCAACTGCATTATCGAC
CCGACCGTTGGTGCTTATGACGACCGTATCTGGACGCGCAGCATCGTCGGCTGGCCGGGTGTTAACCATCTGGAAGGCGA
CGACTTCGCACCGGTGATCCGCCAGGCGCAGCAGATGTCCGGCTTCCCGTTCAGCGAAATCGAACACCTGATCACCGTCG
GTTTTGGTCGCCAGACGCTGCTTGGCGCGGTGGATTCACTGATTGATTTGGTGAGCCGTGAAAAACTGCGTCACGTCTTC
CTCGTTGGTGGCTGTGACGGTGCGCGCGGTGAGCGTAACTACTTTACCGACTTCGCCACCCAGGTGCCGGATGACTGCCT
GATCCTGACGCTGGCCTGCGGTAAATACCGCTTTAACAAACTCGACTTTGGCAACATTGAAGGTCTGCCGCGCCTGATTG
ATGCGGGTCAGTGTAACGATGCTTACTCAGCCATCATCCTGGCGGTGACGCTGGCGGAAAAACTGGGCTGCGGTGTTAAC
GATCTGCCGCTGTCGCTGGTGCTCTCCTGGTTCGAACAAAAAGCGATTGTCATCCTGCTGACTCTGCTCTCGCTGGGTGT
GACGAATATTGTCACCGGGCCGACGGCCCCGGGCTTCCTGACGCCGGATCTGCTGGCGGTGCTGAATGAGAAATTCGGCC
TGCGCCAGGTCACGACCGTGGAACAGGATATGCAGCAGTTGCTGAGCGCATAA