Detailed information of effector


Summary

Effector ID EFF01838 experimental
Effector type Tde
Cognate immunity protein IMU00355 experimental
Related T6SS (Type) T6SS00014 experimental (Type i4b)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (1386 a.a.); Nucleotide sequence (4158 bp)
Description Tke2 is an effector of the K1-T6SS and its activity is antagonized by the Tki2 immunity protein
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PP_3108 (Tke2)
Coordinates (Strand) 3511333..3515490 (+)
NCBI ID 499256461
RefSeq NC_002947
Uniprot ID A0A2V4FUX2_9PSED, Q88I91_PSEPK
KEGG ID ppu:PP_3108
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 7.5e-21 232..305
RHS PF03527.16 2.2e-17 1172..1204
PAAR_motif PF05488.15 1.9e-16 73..138
RHS_repeat PF05593.16 1.3e-07 859..894
RHS_repeat PF05593.16 1.3e-05 547..585

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-14 MFEAARFGDEISHT
Transmembrane helix 15-37 SALGGFLIGAALGIALVATVAIA
Inside 38-41 TFTC
Transmembrane helix 42-64 GFGVALLAGLAAGIGGSLLTAAG
Outside 65-1385 EAIGSMFSSPSGTITTASPNVFINSRKAARVEKSIGACDKHPGPVQIAEGSTNVFINSVAAARKGDKLTCGATISGGSDNVIIGGGTYRYLPVDDEVPEWLRTTVDVLMAIAGAAGGIAQLIKAGTQAGMKAVMPCALKFTAGFVAGEVASRYVVEPVARKAIGGLVGNPVDLTTGRKLIPDEIDFSLPGLMPIEWSRFYASDLTVDSVLGRGWVLPWEQSLRRQGAFIYLTDNQGREVPFVTLQPGQRIYNPHEQVYLVCTEGGHYILQTLDNLFFYFGEVPDTNTEVPLQRIENVLGHFLHFTRTPDGTLTDISATGGTRVHLHYDNPLGRLTDIKRVVNNEAVETLTQYRYDEHGQLSAVINRNGDTVRSFSYADGLMVTHSNALGLGCHYRWQTLGDKPRVVEHWTSDGEHYHFRYDLDSRTSWATDVLGRELEVQYNADHRVVASRDYGGERYAIELDEHGNMVGLTLPDGNRLQFKYDEFSRLLEETDPLGRKTQYEYHHLTTLVTQVSYPDGSTWRARFDDKGNLLAEFDALGQMTEYLNSDDGLPHTIIDATYKSKYLWWNTLAQVERYQDCSGKSTYYRYDERQHLVAVTDALNQTTTLARKPDGEVLRISHPDGTTESFTYNVYGQVLSHTDGKGQTTRLMRTARGLPSSRQDAKGQRVRYEYDKAMRLTALVNENNATYSFAYDASDRLSEEVRVDNLTRRFSYDVGGHLTRLDEIGYGENAERPERHTLFERDAIGRLIAKLNSDAQQRFTYDDGDRLLSIERQPTGIGKQLGITEEKLEYAYDLLGRLTKEISPDGTLGYEYDPLSNLTTLTLPDGRKVNHLYYGSGHLHQLNLDGQVISDMERDDLHREVYRTQGKLTSCFGYDAMGRKAWQFASTLPADKLSQVHNTGINTSLLVEHAYNPIHRRYQYDPAGELVRTLDKLRGEIKYEYEANGQLRSRDTGSLIGSEEFRYDPAANRLDFNARQFDKVKDNRIKQWRDQEYRYDPWGNLIEKRSGHSKLQHFSYDCENRLVRAETLVNGKLESQGEYRYDSLGRRIAKQAEINGEVEQKRFLWQGLRMLREETPGQSILYLYEPGSYAPLARVDQVEGEGQKVYYFHTDQIGTPLELTDSEGEIVWQATYRSWGTIETLSIKEVDQNLRFQGQYFDAETGLHYNTFRYYYSEVGRYVTQDPIGLDGGLNLYRYGQNPAGWIDPWGWECWSTARKNYWKAEAKAPTRAYSPTNLVRMAEGKAPKMTVEVISRKTDKISIREYALELHHNDIPQRVGGAGVHDSSNLLALTPWEHEAVDQFRHVGSDLIRVIKGVDVW



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9686 - -



  Protein sequence: 1386 a.a.    .

>EFF01838 NC_002947:3511333-3515490 [Pseudomonas putida KT2440]
MFEAARFGDEISHTSALGGFLIGAALGIALVATVAIATFTCGFGVALLAGLAAGIGGSLLTAAGEAIGSMFSSPSGTITT
ASPNVFINSRKAARVEKSIGACDKHPGPVQIAEGSTNVFINSVAAARKGDKLTCGATISGGSDNVIIGGGTYRYLPVDDE
VPEWLRTTVDVLMAIAGAAGGIAQLIKAGTQAGMKAVMPCALKFTAGFVAGEVASRYVVEPVARKAIGGLVGNPVDLTTG
RKLIPDEIDFSLPGLMPIEWSRFYASDLTVDSVLGRGWVLPWEQSLRRQGAFIYLTDNQGREVPFVTLQPGQRIYNPHEQ
VYLVCTEGGHYILQTLDNLFFYFGEVPDTNTEVPLQRIENVLGHFLHFTRTPDGTLTDISATGGTRVHLHYDNPLGRLTD
IKRVVNNEAVETLTQYRYDEHGQLSAVINRNGDTVRSFSYADGLMVTHSNALGLGCHYRWQTLGDKPRVVEHWTSDGEHY
HFRYDLDSRTSWATDVLGRELEVQYNADHRVVASRDYGGERYAIELDEHGNMVGLTLPDGNRLQFKYDEFSRLLEETDPL
GRKTQYEYHHLTTLVTQVSYPDGSTWRARFDDKGNLLAEFDALGQMTEYLNSDDGLPHTIIDATYKSKYLWWNTLAQVER
YQDCSGKSTYYRYDERQHLVAVTDALNQTTTLARKPDGEVLRISHPDGTTESFTYNVYGQVLSHTDGKGQTTRLMRTARG
LPSSRQDAKGQRVRYEYDKAMRLTALVNENNATYSFAYDASDRLSEEVRVDNLTRRFSYDVGGHLTRLDEIGYGENAERP
ERHTLFERDAIGRLIAKLNSDAQQRFTYDDGDRLLSIERQPTGIGKQLGITEEKLEYAYDLLGRLTKEISPDGTLGYEYD
PLSNLTTLTLPDGRKVNHLYYGSGHLHQLNLDGQVISDMERDDLHREVYRTQGKLTSCFGYDAMGRKAWQFASTLPADKL
SQVHNTGINTSLLVEHAYNPIHRRYQYDPAGELVRTLDKLRGEIKYEYEANGQLRSRDTGSLIGSEEFRYDPAANRLDFN
ARQFDKVKDNRIKQWRDQEYRYDPWGNLIEKRSGHSKLQHFSYDCENRLVRAETLVNGKLESQGEYRYDSLGRRIAKQAE
INGEVEQKRFLWQGLRMLREETPGQSILYLYEPGSYAPLARVDQVEGEGQKVYYFHTDQIGTPLELTDSEGEIVWQATYR
SWGTIETLSIKEVDQNLRFQGQYFDAETGLHYNTFRYYYSEVGRYVTQDPIGLDGGLNLYRYGQNPAGWIDPWGWECWST
ARKNYWKAEAKAPTRAYSPTNLVRMAEGKAPKMTVEVISRKTDKISIREYALELHHNDIPQRVGGAGVHDSSNLLALTPW
EHEAVDQFRHVGSDLIRVIKGVDVW*

  Nucleotide sequence: 4158 bp    .

>EFF01838 NC_002947:3511333-3515490 [Pseudomonas putida KT2440]
ATGTTCGAAGCGGCCAGGTTCGGCGACGAGATATCGCACACCAGCGCGCTGGGGGGCTTCCTGATCGGGGCCGCCCTGGG
GATTGCGCTGGTGGCCACGGTGGCCATTGCCACGTTCACCTGCGGGTTCGGCGTGGCCTTGCTGGCCGGCCTCGCAGCCG
GCATCGGGGGCAGCTTGCTGACCGCCGCCGGAGAGGCGATAGGCAGTATGTTCTCGTCCCCCTCAGGGACGATAACCACT
GCCTCACCCAACGTGTTCATCAACAGCCGCAAGGCCGCCCGCGTCGAAAAAAGCATCGGTGCCTGCGACAAGCACCCAGG
GCCGGTGCAGATTGCCGAAGGCTCGACCAACGTCTTCATCAACAGCGTCGCCGCCGCGCGCAAGGGCGACAAGCTGACCT
GCGGCGCCACCATTTCCGGTGGTTCGGACAACGTCATCATCGGCGGCGGCACCTACCGTTACCTGCCCGTGGACGATGAA
GTCCCGGAGTGGCTGCGCACCACCGTGGATGTGCTGATGGCCATCGCCGGTGCCGCAGGCGGTATCGCCCAGCTGATCAA
GGCGGGTACCCAGGCCGGCATGAAAGCCGTCATGCCTTGCGCCCTGAAGTTCACGGCCGGCTTCGTCGCCGGTGAGGTGG
CCAGCCGTTATGTGGTCGAACCCGTGGCCCGCAAGGCTATCGGCGGCCTGGTCGGCAACCCCGTCGACCTCACGACGGGC
CGCAAGCTGATCCCCGATGAAATCGACTTCAGCCTGCCGGGCCTGATGCCGATCGAGTGGTCGCGCTTCTACGCCAGCGA
CCTGACGGTCGACAGCGTACTCGGCCGCGGCTGGGTGCTGCCCTGGGAGCAGAGCCTGCGCCGCCAGGGGGCATTCATCT
ACCTCACCGACAACCAGGGCCGCGAAGTCCCGTTCGTGACCCTGCAACCGGGGCAGCGCATCTACAACCCGCACGAGCAG
GTGTACCTGGTGTGCACCGAGGGCGGTCACTACATCCTGCAGACCCTCGACAACCTGTTCTTCTACTTTGGCGAAGTGCC
AGACACCAACACCGAAGTGCCGCTGCAGCGTATCGAGAACGTCCTCGGCCACTTCCTGCACTTCACCCGCACGCCCGACG
GCACACTGACCGACATCAGCGCCACCGGCGGCACCCGCGTGCACCTGCACTACGACAACCCGCTGGGTCGCCTGACCGAC
ATCAAGCGCGTGGTGAACAACGAAGCGGTGGAAACGCTTACCCAGTACCGCTACGACGAACACGGCCAGCTGAGCGCGGT
GATCAACCGCAACGGCGACACCGTGCGCAGCTTCAGCTACGCCGACGGCCTGATGGTGACCCACAGCAACGCGCTGGGGC
TGGGCTGCCACTACCGTTGGCAAACCCTGGGCGACAAGCCACGCGTGGTCGAACACTGGACCAGCGACGGCGAGCACTAC
CACTTCCGCTACGACCTCGATAGCCGCACCAGCTGGGCCACCGACGTGCTCGGCCGCGAGCTGGAAGTGCAGTACAACGC
CGACCACCGCGTGGTCGCCAGCCGCGATTATGGCGGGGAGCGTTACGCCATCGAGCTGGACGAACACGGCAATATGGTTG
GCCTGACCTTGCCGGACGGTAACCGCCTGCAATTCAAGTACGACGAATTCTCCCGCCTGCTCGAAGAGACCGACCCGCTG
GGCCGCAAGACCCAGTACGAATATCACCACCTGACCACACTGGTGACCCAGGTCAGCTACCCGGATGGCAGCACTTGGCG
AGCGCGTTTCGACGACAAGGGCAACCTGCTCGCCGAATTCGATGCCCTCGGCCAGATGACCGAGTACCTGAACAGCGATG
ACGGCCTGCCGCACACCATCATCGATGCGACCTACAAGTCCAAGTACCTGTGGTGGAACACCCTGGCCCAGGTCGAGCGC
TACCAGGACTGCTCGGGCAAGAGTACGTACTACCGCTATGACGAACGCCAGCACCTGGTCGCAGTAACCGACGCGCTGAA
CCAGACCACCACGCTGGCGCGCAAGCCCGACGGCGAAGTGCTGCGCATCAGCCACCCGGACGGCACCACGGAAAGCTTCA
CCTACAACGTCTACGGTCAGGTGCTCAGCCACACCGACGGCAAGGGCCAGACCACCCGCCTGATGCGCACGGCCCGCGGC
CTGCCGAGCAGCCGCCAGGATGCCAAGGGCCAGCGGGTTCGCTACGAGTACGACAAGGCCATGCGCCTGACCGCGCTGGT
CAACGAAAACAACGCCACGTACAGCTTTGCCTACGACGCTTCGGACCGACTGAGCGAAGAAGTGCGGGTGGATAACCTGA
CCCGGCGTTTCAGCTACGACGTCGGTGGCCATCTCACACGACTGGATGAGATTGGCTATGGCGAAAATGCCGAGCGGCCC
GAGCGCCATACGCTGTTCGAGCGTGATGCCATTGGTCGCCTGATCGCCAAACTGAATAGCGACGCACAACAGCGATTCAC
CTATGACGACGGTGACCGGTTGCTGAGCATCGAGCGCCAACCGACCGGGATCGGCAAGCAGCTTGGGATCACGGAAGAAA
AGCTTGAGTACGCCTACGATCTGCTCGGTCGGCTGACCAAAGAAATCAGCCCTGACGGCACGCTCGGCTACGAGTACGAC
CCGCTCAGCAACCTGACCACGCTGACCCTGCCGGATGGCCGCAAGGTCAATCACCTGTACTACGGCAGCGGCCACCTGCA
CCAGCTGAACCTGGATGGTCAGGTGATCAGCGACATGGAGCGCGATGACCTGCACCGCGAGGTGTACCGGACCCAGGGCA
AGCTCACCAGTTGCTTCGGTTATGACGCCATGGGGCGCAAGGCCTGGCAGTTTGCCTCGACCTTGCCGGCCGACAAGCTT
TCGCAGGTGCACAACACCGGCATCAATACCTCGTTGCTGGTCGAGCACGCCTACAACCCGATCCACCGCCGTTACCAGTA
CGACCCGGCCGGTGAACTGGTGCGTACCCTCGACAAGCTACGCGGCGAGATCAAGTACGAGTACGAAGCCAACGGCCAGT
TGCGCAGTCGCGATACCGGCTCGTTGATCGGCAGTGAGGAGTTCCGCTACGACCCGGCAGCCAACCGCCTGGACTTCAAT
GCGCGGCAATTCGACAAGGTCAAGGACAACCGGATCAAGCAGTGGCGGGACCAGGAGTACCGCTACGATCCGTGGGGCAA
CCTGATCGAGAAGCGCTCTGGGCACAGCAAGCTGCAGCACTTCAGCTACGACTGCGAGAACCGGCTGGTGCGGGCGGAGA
CGTTGGTCAATGGCAAGCTGGAAAGCCAAGGCGAGTATCGTTACGACAGCTTGGGGAGGCGAATAGCCAAGCAGGCTGAA
ATCAATGGCGAGGTCGAGCAGAAGCGCTTCCTCTGGCAAGGGCTAAGGATGCTGCGGGAGGAAACGCCAGGGCAGAGCAT
CTTGTACCTGTACGAGCCGGGTAGCTATGCGCCATTGGCGCGGGTTGATCAGGTTGAAGGAGAAGGGCAGAAGGTCTATT
ACTTCCATACCGATCAGATTGGGACGCCGCTTGAGCTGACGGATAGCGAGGGTGAGATTGTTTGGCAGGCGACGTATCGC
TCTTGGGGCACGATAGAAACTTTGTCGATCAAAGAGGTCGATCAGAATCTGCGCTTCCAAGGTCAGTACTTTGATGCTGA
AACAGGGCTGCACTATAATACCTTCCGATATTATTATTCTGAAGTGGGACGTTATGTCACTCAGGACCCTATTGGTTTAG
ATGGCGGGCTAAATCTTTATCGCTATGGTCAGAATCCGGCAGGGTGGATCGACCCGTGGGGATGGGAGTGTTGGAGTACT
GCTCGAAAAAACTATTGGAAAGCTGAGGCCAAAGCACCTACTCGTGCCTACTCACCCACAAACCTTGTGCGTATGGCTGA
GGGGAAAGCGCCCAAAATGACAGTTGAGGTGATTTCGCGCAAGACCGATAAAATATCAATTAGAGAGTATGCATTAGAAC
TTCATCATAATGATATTCCTCAGCGAGTGGGTGGGGCGGGTGTACATGATTCGTCAAATTTGCTCGCGCTTACTCCGTGG
GAGCATGAGGCTGTCGACCAGTTTAGGCATGTAGGGTCTGACTTGATTAGAGTAATTAAAGGAGTTGATGTATGGTAA