Detailed information of effector


Summary

Effector ID EFF01835 experimental
Effector type Tde
Cognate immunity protein -
Related T6SS (Type) T6SS01170 experimental (Type i1)
Strain Pectobacterium brasiliense strain 1692
Replicon chromosome
Sequence Protein sequence (205 a.a.); Nucleotide sequence (615 bp)
Description endonuclease (AHH family)
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) GT391_RS21640 (AHH)
Coordinates (Strand) 1694162..1694776 (-)
NCBI ID 1194668254
RefSeq NZ_CP047495
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AHH PF14412.8 1.2e-12 101..194

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-204 MPKHNQQEYPSRAVGAQTGGRLCYNRFRYYDPNDGCYVSPDPIGVLGGENNYGYVHNPMDWVDPFGLAGCARILASNMKAANKLLAQNAGYMTIGWHKYWGSAAHHIVAGADRRADIARSILDKAGIKIDDAVNGVFLKHIKKISPQPGAYHRVIHTDKYYQEITRIMQRAEMRAGGGLSKLTENVNSALSSIRDSLVSGTFKY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7646 - -



  Protein sequence: 205 a.a.    .

>EFF01835 NZ_CP047495:c1694776-1694162 [Pectobacterium brasiliense]
MPKHNQQEYPSRAVGAQTGGRLCYNRFRYYDPNDGCYVSPDPIGVLGGENNYGYVHNPMDWVDPFGLAGCARILASNMKA
ANKLLAQNAGYMTIGWHKYWGSAAHHIVAGADRRADIARSILDKAGIKIDDAVNGVFLKHIKKISPQPGAYHRVIHTDKY
YQEITRIMQRAEMRAGGGLSKLTENVNSALSSIRDSLVSGTFKY*

  Nucleotide sequence: 615 bp    .

>EFF01835 NZ_CP047495:c1694776-1694162 [Pectobacterium brasiliense]
CTGCCAAAACACAACCAGCAGGAATACCCAAGCCGGGCGGTTGGTGCGCAGACAGGCGGCCGGTTATGCTATAACCGTTT
TCGGTACTACGACCCGAACGATGGTTGCTACGTCTCGCCTGACCCTATAGGGGTGCTGGGTGGGGAGAATAATTACGGAT
ACGTACATAACCCGATGGACTGGGTTGATCCGTTTGGGTTGGCTGGTTGCGCTCGAATACTAGCGAGTAATATGAAAGCG
GCAAATAAGCTCTTAGCTCAAAATGCTGGCTATATGACAATTGGGTGGCATAAATATTGGGGGTCTGCAGCACACCATAT
AGTAGCTGGCGCAGATAGGCGGGCTGATATAGCAAGAAGCATTTTAGACAAGGCTGGAATCAAAATTGATGATGCTGTAA
ACGGTGTGTTTTTAAAGCATATCAAGAAAATATCTCCGCAGCCTGGTGCTTATCATCGAGTTATCCACACCGATAAATAT
TATCAAGAGATTACTAGGATTATGCAAAGAGCAGAAATGCGTGCGGGAGGTGGCCTGAGTAAGCTTACAGAAAATGTGAA
TTCTGCACTATCCAGCATTAGAGATTCACTTGTTTCAGGGACGTTTAAATATTGA