Detailed information of effector


Summary

Effector ID EFF01833 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01247 experimental (Type i1)
Strain Vibrio parahaemolyticus strain T9109
Replicon chromosome
Sequence Protein sequence (693 a.a.); Nucleotide sequence (2079 bp)
Description VgrG
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PO79_RS04645 (VgrG1)
Coordinates (Strand) 231739..233817 (-)
NCBI ID 491637679
RefSeq NZ_JTGR01000038
Uniprot ID A0A2R9VRD7_VIBPH
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 2.3e-77 26..331
Phage_base_V PF04717.14 8.8e-15 387..455

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-692 MVNDVEFKFEVPGCGHEFRVESFQVNEELSKPFHISLSLLSLDPDISFDSLIRKAGTLTLYGQGLSAARIFNGVVNEVRYLGTGRRFSRYQLVLVPQAWFLSQRQDCRIFQQKSAKDIITEVLDDGSVTDYRFELSGIYPPKEYALQYRESDLHFVQRMMAEHGMWYYFDHTDSNHTMVIVDSNDAIAPLVSSPLNASYIGPIVYHADSGGVADREHISDLELVNRVRTGQVTYTDYNYEQPKIPQEMTHAGDLDQDLKQFDYPGRYVDPVMGQVRTTEWMSEHIVDNQQVEASSDVMRLASGYSFNISDHPRSEINRDYIMLSVMHTGQDPQVHEDEASGMPTTYYNQFTCIPRDVVFKAPKLAAPVVDGPQTAVVVGPAGEEIYTDKLGRIKVQFHWDRYGNNDEHASCWIRVSQSMAAPTWGAVYLPRIGHEVVVTFLEGDPDRPLVTGAVYNGLHFPPYSLPENKTRTTFRTQTHKGTGYNELSFEDEANQEEVYIHAQKDMSTKVLNNRYRDIGQDEFLKVARHQTNEVHGDHKETIDGHKTTQVNSTFTETVEQDVTVTYNANETQYVKNNSDLEIGDNRTTKIGKNDDLDVGENSNLTVGASKSSDIGADDNQTVGGNLTVSVKGNTSYKADGATQIISGDKIVLKTGGSSLVMNSDGSIKLSGSSITIEGSDKVVVKGGNVAIN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9826 - -



  Protein sequence: 693 a.a.    .

>EFF01833 NZ_JTGR01000038:c233817-231739 [Vibrio parahaemolyticus]
MVNDVEFKFEVPGCGHEFRVESFQVNEELSKPFHISLSLLSLDPDISFDSLIRKAGTLTLYGQGLSAARIFNGVVNEVRY
LGTGRRFSRYQLVLVPQAWFLSQRQDCRIFQQKSAKDIITEVLDDGSVTDYRFELSGIYPPKEYALQYRESDLHFVQRMM
AEHGMWYYFDHTDSNHTMVIVDSNDAIAPLVSSPLNASYIGPIVYHADSGGVADREHISDLELVNRVRTGQVTYTDYNYE
QPKIPQEMTHAGDLDQDLKQFDYPGRYVDPVMGQVRTTEWMSEHIVDNQQVEASSDVMRLASGYSFNISDHPRSEINRDY
IMLSVMHTGQDPQVHEDEASGMPTTYYNQFTCIPRDVVFKAPKLAAPVVDGPQTAVVVGPAGEEIYTDKLGRIKVQFHWD
RYGNNDEHASCWIRVSQSMAAPTWGAVYLPRIGHEVVVTFLEGDPDRPLVTGAVYNGLHFPPYSLPENKTRTTFRTQTHK
GTGYNELSFEDEANQEEVYIHAQKDMSTKVLNNRYRDIGQDEFLKVARHQTNEVHGDHKETIDGHKTTQVNSTFTETVEQ
DVTVTYNANETQYVKNNSDLEIGDNRTTKIGKNDDLDVGENSNLTVGASKSSDIGADDNQTVGGNLTVSVKGNTSYKADG
ATQIISGDKIVLKTGGSSLVMNSDGSIKLSGSSITIEGSDKVVVKGGNVAIN*

  Nucleotide sequence: 2079 bp    .

>EFF01833 NZ_JTGR01000038:c233817-231739 [Vibrio parahaemolyticus]
ATGGTGAATGACGTAGAATTTAAATTTGAAGTGCCAGGGTGTGGGCACGAGTTTCGAGTAGAAAGCTTTCAAGTAAATGA
AGAGCTTTCGAAACCTTTTCACATCAGTCTCTCATTACTTTCACTTGATCCAGATATCTCTTTTGATTCGTTAATACGAA
AAGCAGGTACACTGACTCTTTATGGACAAGGCTTAAGCGCGGCACGCATATTCAATGGTGTGGTGAACGAAGTTCGTTAT
TTGGGTACAGGCCGTCGCTTCTCTCGCTATCAGTTAGTTTTGGTTCCGCAGGCTTGGTTCTTATCACAACGCCAAGACTG
TCGTATTTTCCAACAAAAATCAGCGAAAGATATAATTACAGAGGTGCTTGATGATGGTTCAGTGACCGACTATCGTTTTG
AACTATCTGGTATTTATCCACCAAAAGAGTACGCGCTGCAATACCGTGAGTCAGACCTACACTTTGTTCAGCGTATGATG
GCAGAACACGGTATGTGGTACTATTTCGACCACACCGATTCAAACCACACAATGGTCATTGTCGATAGTAACGATGCCAT
TGCTCCACTGGTTAGCTCTCCTCTCAATGCATCTTATATTGGGCCGATTGTATATCACGCCGATAGTGGGGGTGTTGCTG
ACCGTGAGCATATCTCCGATCTCGAGTTAGTTAACCGTGTGAGAACGGGTCAGGTTACTTACACTGACTACAATTACGAG
CAGCCAAAGATCCCGCAAGAGATGACTCATGCAGGTGATCTGGACCAAGATTTAAAGCAGTTTGATTATCCTGGACGTTA
TGTTGATCCTGTAATGGGGCAGGTGAGAACCACTGAGTGGATGTCTGAGCACATTGTCGATAATCAGCAAGTAGAAGCGA
GCAGTGATGTGATGCGTTTGGCGTCTGGTTACAGCTTTAACATCAGTGACCATCCTCGCTCTGAAATCAACCGTGATTAC
ATCATGTTATCCGTCATGCACACAGGGCAAGACCCACAAGTGCACGAAGACGAAGCGAGTGGCATGCCAACTACTTACTA
CAACCAGTTCACGTGTATTCCACGTGATGTTGTATTCAAAGCGCCCAAGTTGGCGGCTCCAGTAGTGGATGGTCCGCAAA
CTGCGGTTGTAGTTGGTCCTGCAGGGGAGGAGATCTACACCGATAAACTAGGACGAATTAAGGTTCAGTTCCATTGGGAT
CGCTATGGTAACAACGATGAACATGCAAGTTGTTGGATTCGTGTGAGTCAATCAATGGCTGCTCCAACGTGGGGCGCGGT
TTACTTGCCACGTATTGGTCATGAAGTCGTAGTCACCTTCCTTGAAGGCGACCCAGATCGCCCATTGGTGACTGGCGCAG
TTTATAACGGTCTTCACTTCCCTCCGTACTCGTTGCCTGAGAACAAAACTCGTACTACGTTCCGTACGCAAACGCACAAA
GGCACCGGCTACAACGAACTGAGTTTTGAAGACGAAGCGAACCAAGAAGAAGTCTACATTCATGCTCAAAAAGACATGTC
GACCAAAGTTCTCAACAATCGTTACCGAGATATCGGTCAGGATGAGTTCTTAAAGGTTGCGCGTCATCAGACGAACGAAG
TCCATGGTGATCATAAAGAAACCATTGATGGCCACAAAACAACCCAAGTAAACAGCACTTTTACCGAGACAGTAGAGCAA
GACGTTACCGTTACATACAACGCCAACGAAACCCAATATGTGAAGAACAATTCTGATTTGGAAATTGGTGATAACCGCAC
AACCAAGATCGGCAAGAACGATGACTTGGATGTGGGTGAAAACAGTAACTTAACTGTTGGTGCATCAAAAAGCTCGGACA
TTGGTGCGGATGATAACCAAACAGTGGGTGGCAACTTAACCGTATCGGTAAAAGGCAATACATCTTACAAAGCCGATGGC
GCGACACAGATCATCAGTGGTGACAAGATTGTACTGAAAACAGGCGGTTCTTCTTTAGTGATGAACAGTGATGGTTCAAT
CAAGCTCTCAGGGTCTTCAATCACCATTGAAGGCAGCGATAAAGTCGTCGTGAAAGGTGGTAACGTAGCGATTAACTAA