Detailed information of effector


Summary

Effector ID EFF01831 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00720 experimental (Type i5)
Strain Vibrio parahaemolyticus BB22OP
Replicon chromosome
Sequence Protein sequence (160 a.a.); Nucleotide sequence (480 bp)
Description hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VPBB_RS19920 (Hcp2)
Coordinates (Strand) 1050543..1051022 (-)
NCBI ID 491518336
RefSeq NC_019971
Uniprot ID A0A2I3CRH4_VIBAX, S5J041_VIBPH, Q87HD8_VIBPA, A0A0T7E196_9VIBR, C0LZR3_VIBAL, D0X0J5_VIBAL
KEGG ID vag:N646_4398, vpf:M634_23055, vpa:VPA1027
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 1.2e-28 6..133

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-159 MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTITKLQDRSSPDLFKEATIGKGKPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPVETITISYTEMMMTVTPTDDKNNTSAPLVYGYSGVKGQQM



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9833 - -



  Protein sequence: 160 a.a.    .

>EFF01831 NC_019971:c1051022-1050543 [Vibrio parahaemolyticus BB22OP]
MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTITKLQDRSSPDLFKEATIGKG
KPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPVETITISYTEMMMTVTPTDDKNNTSAPLVYGYSGVKGQQM*

  Nucleotide sequence: 480 bp    .

>EFF01831 NC_019971:c1051022-1050543 [Vibrio parahaemolyticus BB22OP]
ATGCAGTCTAATACGTATCTTAAATACGCAGATATTAAAGGTGAAGCGACAGCGGAACAATATAAGGATTTAATTACACT
ACTATCTGTAGATTGGAGTGTTGGTCGTGAAATTTCTTCTTACACGGGTACAGCAATGGACCGTGAAGCAAGTGCAACAC
GCCTATATGATTTAACTATCACTAAACTTCAAGATCGTTCGTCTCCTGATCTATTCAAGGAAGCAACAATCGGTAAAGGT
AAACCTGCAGTATTCCACATCACTAAGCAGGGTGAAAAAGTTGAAGAAATCATGAAAATCGAACTGACTGATGCGATGAT
TTCTAACTACTCAGTATCGATTCAAGATGATCGCCCAGTAGAAACTATCACAATTTCATACACTGAAATGATGATGACAG
TGACACCTACTGATGACAAAAACAACACTTCTGCTCCGTTGGTTTACGGTTACAGCGGTGTTAAAGGTCAACAAATGTAA