Detailed information of effector


Summary

Effector ID EFF01829 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01262 experimental (Type i1)
Strain Vibrio parahaemolyticus strain 12-297/B C4271
Replicon chromosome
Sequence Protein sequence (693 a.a.); Nucleotide sequence (2079 bp)
Description VgrG
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) B5C30_RS14470 (VgrG1b)
Coordinates (Strand) 20614..22692 (-)
NCBI ID 490886759
RefSeq NZ_MYFG01000470
Uniprot ID F9TD79_9VIBR
KEGG ID vtu:IX91_04925
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 7.8e-74 26..331
Phage_base_V PF04717.14 4.8e-13 387..455

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-693 MVNDVNFTFDVSGFSGAFKVESFRITETVSSSFEMNLTVLSDDDAITFEALSRKMGVLSLFGQGVGTARQFNGCISELRYLGTGRRFSRYHITLVPHLWFLTQRQDCRIFQMQTAPDIIRQVFDDAGMSDYRFELSAQYEAKEYVLQYRESDQHFVQRLMAEHGLWYYFEHSDAGHTMVIVDSNDAIPELISTPINASYLGPVIYHAQGGGTPDREHIFDLEQIHRTRTGLVSYGDYNYLTPKTPQGKSADEGPNFDLQRYDYLGRYTTPELGQQRATEWMSEYTVDSHQIEAASDIMRLTAGYSFDISQHPRSGINRDYLMLTVMHTGFNPRVHEEESSDEPTTYHNQFVCLPRDVTFRVPKMASPVVDGPQTAVVVGPAGEEIYTDEYGRIKVQFHWDRYAQSDEHSSCWLRVSQSMAALNWGAVYLPRIGHEVIVTFLEGDPDRPLVTGAVYNGLHTPPYPLPENKTRTVFRTQSHKAEGYNEMYFEDENDQEVVHFRAQKDMKTKVLNNRYRDIGNDEELKVGNKQENKILGNRKEEIDGHKTSIAKQTFTEEIIGDVSASYNTNLSKKVASNQSKKIQYNHKTIIGKSDELLVDGELSQEIWQSRSIDVGGDDNQNIRQHLTVRVGSNTSIKSDEQTAVISSDEIRLQVGASGLLLKNDGKIHLYGTSVTVDGASNISVKGAKVNMNP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9854 - -



  Protein sequence: 693 a.a.    .

>EFF01829 NZ_MYFG01000470:c22692-20614 [Vibrio parahaemolyticus]
MVNDVNFTFDVSGFSGAFKVESFRITETVSSSFEMNLTVLSDDDAITFEALSRKMGVLSLFGQGVGTARQFNGCISELRY
LGTGRRFSRYHITLVPHLWFLTQRQDCRIFQMQTAPDIIRQVFDDAGMSDYRFELSAQYEAKEYVLQYRESDQHFVQRLM
AEHGLWYYFEHSDAGHTMVIVDSNDAIPELISTPINASYLGPVIYHAQGGGTPDREHIFDLEQIHRTRTGLVSYGDYNYL
TPKTPQGKSADEGPNFDLQRYDYLGRYTTPELGQQRATEWMSEYTVDSHQIEAASDIMRLTAGYSFDISQHPRSGINRDY
LMLTVMHTGFNPRVHEEESSDEPTTYHNQFVCLPRDVTFRVPKMASPVVDGPQTAVVVGPAGEEIYTDEYGRIKVQFHWD
RYAQSDEHSSCWLRVSQSMAALNWGAVYLPRIGHEVIVTFLEGDPDRPLVTGAVYNGLHTPPYPLPENKTRTVFRTQSHK
AEGYNEMYFEDENDQEVVHFRAQKDMKTKVLNNRYRDIGNDEELKVGNKQENKILGNRKEEIDGHKTSIAKQTFTEEIIG
DVSASYNTNLSKKVASNQSKKIQYNHKTIIGKSDELLVDGELSQEIWQSRSIDVGGDDNQNIRQHLTVRVGSNTSIKSDE
QTAVISSDEIRLQVGASGLLLKNDGKIHLYGTSVTVDGASNISVKGAKVNMNP

  Nucleotide sequence: 2079 bp    .

>EFF01829 NZ_MYFG01000470:c22692-20614 [Vibrio parahaemolyticus]
ATGGTTAATGATGTAAACTTCACCTTTGATGTTTCCGGGTTCTCCGGTGCATTTAAAGTCGAAAGCTTTCGAATAACAGA
GACAGTATCTTCCTCCTTTGAAATGAACCTGACGGTGTTGTCCGATGATGATGCCATTACGTTTGAAGCCTTAAGCCGAA
AAATGGGCGTCCTGAGCCTGTTTGGTCAAGGGGTGGGAACGGCTCGTCAGTTTAATGGCTGCATCTCTGAGCTTCGTTAC
TTAGGTACTGGTCGCCGCTTCTCGCGCTATCACATTACCTTGGTTCCACACCTCTGGTTTCTCACTCAGCGCCAAGACTG
TCGAATCTTCCAGATGCAAACCGCGCCGGACATTATTCGTCAGGTTTTTGATGATGCAGGCATGAGCGATTACCGCTTTG
AGTTGTCAGCGCAATATGAAGCGAAAGAGTACGTTCTCCAATACCGTGAGAGTGACCAGCACTTTGTGCAGCGATTAATG
GCAGAGCATGGGCTTTGGTACTATTTCGAACACAGCGACGCTGGACATACCATGGTTATCGTCGATAGCAACGATGCGAT
ACCTGAGCTTATCAGTACGCCTATCAACGCTTCGTACCTAGGACCTGTGATTTATCACGCTCAAGGTGGTGGCACACCAG
ACCGAGAGCATATTTTCGACCTTGAGCAAATCCATAGAACTCGTACTGGGTTAGTGAGCTACGGCGATTACAATTATCTC
ACGCCGAAAACTCCGCAAGGCAAAAGTGCAGATGAGGGTCCGAACTTCGATTTGCAGCGCTACGACTATCTTGGTCGTTA
CACAACGCCAGAATTAGGTCAGCAGCGTGCAACAGAGTGGATGTCTGAATACACGGTGGACAGCCATCAGATTGAGGCCG
CGAGCGATATCATGCGTCTCACCGCAGGCTACAGCTTCGATATCAGTCAGCACCCTCGTTCAGGCATCAACCGTGATTAC
CTCATGTTGACGGTGATGCACACGGGCTTTAACCCTCGTGTGCACGAGGAAGAGTCCAGTGATGAGCCTACAACTTATCA
CAACCAGTTTGTCTGCTTACCACGAGACGTGACATTCCGTGTGCCTAAAATGGCGTCACCTGTCGTTGATGGTCCTCAAA
CTGCCGTTGTGGTTGGTCCTGCGGGTGAAGAAATCTACACCGATGAATATGGACGCATCAAAGTTCAGTTCCATTGGGAC
CGCTACGCACAAAGTGATGAACATAGTTCATGTTGGCTACGTGTCAGTCAGTCAATGGCAGCCCTGAACTGGGGAGCAGT
CTATCTACCTCGCATTGGACATGAAGTGATTGTGACCTTCCTAGAAGGCGACCCAGACCGTCCACTAGTGACGGGCGCGG
TGTACAACGGTTTACATACGCCGCCATACCCGCTGCCAGAAAACAAAACGCGCACCGTATTTAGAACCCAAAGCCATAAG
GCTGAAGGTTACAACGAAATGTATTTTGAGGATGAGAATGACCAAGAAGTGGTGCATTTCCGTGCTCAAAAAGACATGAA
GACCAAAGTGCTCAATAACCGTTATCGAGATATCGGTAATGATGAAGAACTGAAGGTCGGCAACAAACAAGAAAATAAAA
TTTTAGGTAACCGTAAAGAAGAGATTGATGGTCATAAGACTTCTATAGCCAAACAGACCTTCACTGAAGAAATCATTGGG
GATGTTTCTGCTTCATACAACACAAACCTTAGCAAAAAAGTTGCCAGTAACCAAAGCAAAAAAATTCAATATAATCATAA
AACTATCATTGGAAAAAGCGATGAACTATTGGTTGATGGCGAGTTATCTCAAGAGATCTGGCAGTCACGTTCGATTGATG
TCGGTGGGGATGACAACCAAAATATCAGGCAGCATTTGACTGTCAGAGTTGGTAGCAATACATCTATCAAGTCCGACGAA
CAAACGGCTGTGATCAGCTCAGACGAAATTCGATTACAAGTTGGTGCTTCAGGTTTATTACTAAAAAATGACGGGAAAAT
ACATTTATATGGCACAAGTGTAACTGTTGACGGTGCGTCTAACATCAGCGTTAAAGGTGCCAAGGTAAATATGAATCCT