Detailed information of effector


Summary

Effector ID EFF01828 experimental
Effector type Tde
Cognate immunity protein -
Related T6SS (Type) T6SS01103 experimental (Type i5)
Strain Agrobacterium tumefaciens strain 1D1609
Replicon chromosome
Sequence Protein sequence (523 a.a.); Nucleotide sequence (1569 bp)
Description V2a is 522-aa in length and contains a N-terminal PAAR-like DUF4150 domain and a AHH motif in C-terminal nuclease domain belonging to HNH/ENDOVII superfamily (pfam14412) of the treble cleft fold and experimental results show plasmid degradation is caused by nuclease activity of V2a
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) At1D1609_44740 (V2a)
Coordinates (Strand) 1637023..1638591 (+)
NCBI ID 1349686713
RefSeq NZ_CP026925
Uniprot ID A0A2L2LJN7_RHIRD
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4150 PF13665.8 3.5e-32 35..141

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-522 MSIPRDNYIGEPQYPGTWTTATPREGLRDIDEARIVSLAPDVCLTPVGSSVVPIPYPVVDFCGHDKNYTPSVRFTGKKAMVMRSFTTHVHGDAPGNRKGVKSGTVESICEPIGHADQVRAEGSHVIRHLDRFYMNSRNTQGEAIFVRSTQTYDPPKDDDPVRGSLRWQDGSDEGRVMSDASPEPFKEGEKYAYAGSAAAATTGAAQNSAQALRGGMPATRPTVPQTVPRGPGRVITPGPARAPQWYRTPPHRVVSDLAKVGRLARVGIWARRLNVIGILSSVLIPDNGANLSDVVPRDDQERRIKEMFDEGVDAGHDSWEMRDWAMEELRRHRQRVREEPESRPQALPQSETVRVSDRDEYRKKCQVDRYGKMKSVCGQYGMQAHHIVPDWTLRYGAREEADKRIPNMPSLNDGMAICVIGNARVEQTEHWGGHLADKAIENAGRNSTPPFTAPLHKVVQASAQAMISVRPDCAKEIMAALTTQYAGKNPFQLLRAKQYPPLPEETISALKSGAVEGATRKP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9773 - -



  Protein sequence: 523 a.a.    .

>EFF01828 NZ_CP026925:1637023-1638591 [Agrobacterium tumefaciens]
MSIPRDNYIGEPQYPGTWTTATPREGLRDIDEARIVSLAPDVCLTPVGSSVVPIPYPVVDFCGHDKNYTPSVRFTGKKAM
VMRSFTTHVHGDAPGNRKGVKSGTVESICEPIGHADQVRAEGSHVIRHLDRFYMNSRNTQGEAIFVRSTQTYDPPKDDDP
VRGSLRWQDGSDEGRVMSDASPEPFKEGEKYAYAGSAAAATTGAAQNSAQALRGGMPATRPTVPQTVPRGPGRVITPGPA
RAPQWYRTPPHRVVSDLAKVGRLARVGIWARRLNVIGILSSVLIPDNGANLSDVVPRDDQERRIKEMFDEGVDAGHDSWE
MRDWAMEELRRHRQRVREEPESRPQALPQSETVRVSDRDEYRKKCQVDRYGKMKSVCGQYGMQAHHIVPDWTLRYGAREE
ADKRIPNMPSLNDGMAICVIGNARVEQTEHWGGHLADKAIENAGRNSTPPFTAPLHKVVQASAQAMISVRPDCAKEIMAA
LTTQYAGKNPFQLLRAKQYPPLPEETISALKSGAVEGATRKP*

  Nucleotide sequence: 1569 bp    .

>EFF01828 NZ_CP026925:1637023-1638591 [Agrobacterium tumefaciens]
ATGAGCATCCCCCGCGACAATTATATCGGAGAGCCCCAATATCCCGGCACATGGACCACGGCGACACCGCGTGAGGGACT
GCGTGACATCGATGAGGCGCGTATCGTCTCTTTGGCGCCTGATGTATGCCTGACACCGGTTGGCTCGTCGGTGGTGCCTA
TTCCCTATCCGGTCGTGGATTTTTGCGGCCATGATAAAAACTACACGCCGTCTGTTCGGTTCACCGGCAAAAAGGCAATG
GTGATGCGTTCGTTTACGACACATGTGCACGGCGACGCGCCCGGTAACCGTAAGGGGGTAAAATCCGGCACGGTGGAAAG
CATCTGCGAACCCATCGGGCACGCTGATCAGGTGCGTGCCGAAGGCTCGCATGTCATTCGCCACCTCGATCGTTTTTATA
TGAACAGCAGGAATACCCAGGGTGAGGCGATCTTCGTCCGCAGCACGCAGACCTATGATCCTCCCAAGGACGATGATCCG
GTGCGGGGATCGCTCCGATGGCAGGACGGGTCGGACGAAGGCCGGGTTATGAGCGATGCGTCGCCCGAGCCGTTTAAAGA
GGGTGAGAAATACGCTTATGCCGGATCGGCTGCCGCAGCGACGACTGGGGCAGCTCAAAACTCTGCGCAAGCACTTCGCG
GAGGAATGCCGGCGACAAGGCCGACTGTCCCCCAGACTGTTCCTCGTGGTCCGGGAAGGGTGATAACCCCGGGACCCGCC
CGAGCGCCTCAGTGGTATCGTACCCCGCCTCACAGGGTTGTGAGCGATCTTGCAAAAGTTGGCCGTCTCGCGAGGGTGGG
CATTTGGGCCCGCCGCCTAAATGTCATCGGGATATTATCAAGCGTCCTTATCCCCGATAATGGTGCAAATCTGTCTGACG
TCGTCCCACGGGACGATCAGGAGCGGCGGATCAAAGAAATGTTCGACGAGGGTGTCGACGCCGGACATGATAGCTGGGAG
ATGCGGGATTGGGCGATGGAGGAGCTCCGTCGACATCGGCAGCGAGTGCGTGAGGAACCAGAAAGTCGGCCACAGGCATT
ACCCCAGAGCGAAACCGTACGTGTCTCCGATCGGGACGAATACCGCAAGAAGTGTCAGGTCGACCGTTACGGCAAGATGA
AGAGCGTCTGCGGTCAGTACGGCATGCAGGCTCACCATATAGTTCCAGACTGGACGCTTCGTTATGGCGCGAGAGAGGAG
GCCGATAAGCGCATTCCGAATATGCCCAGCCTTAATGATGGTATGGCTATATGTGTTATTGGGAATGCCCGGGTAGAGCA
AACCGAGCACTGGGGTGGTCATCTGGCGGACAAGGCGATCGAAAATGCCGGTAGAAATTCAACGCCACCTTTTACGGCAC
CCTTACATAAAGTAGTTCAGGCGTCGGCCCAGGCTATGATAAGCGTGAGGCCCGATTGTGCAAAAGAGATTATGGCAGCC
CTGACGACCCAATATGCTGGAAAAAATCCGTTCCAGCTTTTACGAGCTAAACAATATCCTCCCCTTCCTGAAGAAACCAT
ATCGGCTTTGAAGTCTGGAGCTGTTGAAGGAGCGACCAGAAAACCATGA