Detailed information of effector


Summary

Effector ID EFF01822 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00151 experimental (Type i4a)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (166 a.a.); Nucleotide sequence (498 bp)
Description hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA14_34030 (hcp3)
Coordinates (Strand) 3027086..3027583 (-)
NCBI ID 489180008
RefSeq NC_008463
Uniprot ID V6AEM9_PSEAI, A0A1C7BL22_PSEAI, A0A0H2ZBE0_PSEAB, Q9I1B2_PSEAE, A6V5B9_PSEA7
KEGG ID pae:PA2367, pau:PA14_34030, pap:PSPA7_2894
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 8.8e-29 11..138

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-165 MDAIILDFGSDIKGDSLLVGYENKIEIMSYSHNVAMQVTNDVSNSERTSGKPHVGEFTLTKFIDTSTPTLNEYCCAGKPIAEATITIGRNAAEGNGQIMPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELTAQKDDGTKEGTAASTWDLAANQLVK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9899 - -



  Protein sequence: 166 a.a.    .

>EFF01822 NC_008463:c3027583-3027086 [Pseudomonas aeruginosa UCBPP-PA14]
MDAIILDFGSDIKGDSLLVGYENKIEIMSYSHNVAMQVTNDVSNSERTSGKPHVGEFTLTKFIDTSTPTLNEYCCAGKPI
AEATITIGRNAAEGNGQIMPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELTAQKDDGTKEGTAASTWDLAA
NQLVK*

  Nucleotide sequence: 498 bp    .

>EFF01822 NC_008463:c3027583-3027086 [Pseudomonas aeruginosa UCBPP-PA14]
ATGGATGCGATCATTCTCGATTTCGGCAGCGACATCAAAGGCGACAGCCTGCTCGTCGGCTACGAAAACAAGATCGAAAT
CATGTCCTACAGCCACAACGTGGCGATGCAGGTCACCAACGACGTCAGCAACTCGGAGCGCACCTCCGGCAAACCCCACG
TCGGCGAATTCACCCTCACCAAGTTCATCGACACCTCGACCCCGACCCTCAACGAATACTGCTGCGCCGGCAAGCCGATC
GCCGAGGCGACCATCACCATCGGCCGCAACGCCGCCGAGGGCAACGGGCAGATCATGCCCTTCATCGTCTACACCCTGAA
CAACGTGGTGCTCTCCAACGTCAGCGTCAGCGGCGGCGCCGGCGGCAAGCCGGTGGAGACCCTGTCGCTGAACTTCACCA
AGATCAAGTGGGAGCTGACCGCGCAGAAGGACGACGGCACCAAGGAAGGCACGGCCGCCTCGACCTGGGACCTGGCCGCC
AACCAGTTGGTCAAGTGA