Detailed information of effector


Summary

Effector ID EFF01817 experimental
Effector type Tpe
Cognate immunity protein -
Related T6SS (Type) T6SS00151 experimental (Type i4a)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (1020 a.a.); Nucleotide sequence (3060 bp)
Description VgrG2b is a novel antibacterial protease active in the periplasm, and VgrG2bC-ter metallopeptidase represents a hitherto-undescribed family of antibacterial T6SS effectors that appear to dysregulate the cell division process
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA14_03220 (VgrG2b)
Coordinates (Strand) 285213..288272 (-)
NCBI ID 489228784
RefSeq NC_008463
Uniprot ID A0A0H2ZKV2_PSEAB
KEGG ID pau:PA14_03220
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 1.8e-75 27..327
DUF2345 PF10106.11 9.3e-48 615..758
T6SS_Vgr PF13296.8 3.4e-34 475..581
Phage_base_V PF04717.14 2.1e-13 386..453

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1019 MRQRDLKFTFVVGEGKLAFDVVEFELEEALCEPFRLNLKLASDKNAIDFKQVLDQPGTFTLWQDGRPARYVHGIVSHFTQGSSGFRRTRYELLLEPQLARLELCCNWRIFQEKSVPEILQALLKEHRVLDYEQRIYHEHLPREYCVQAGDSDHYLHDRLAFEEGLVYYFRFDEHRHTLVCSDRLYVQERIAGGPVLFSAQPEGDNPQPVLHSFRYSENVRTARQTQRDYSFKRPTYDQEHHLAGEALEHQDSSYERYDYPGRYKQSGAGRPFSESRLRGHRRDARVASVSGDDPRLIPGHAFALEGHPRADFNAWWRPVRVVHRGTQYAGQEEESADAPLGVSYDLRAELVPEDVEWRPAPLPRPRIDGPQIATVVGPAGEEIHCDEWGRVKVQFPWDREGRHDEFSTCWIRVAQNWAGADWGNMAIPRIGQEVIVDYLDGDCDQPIVTGRTYRATNRPPYALPDHKILSTIKSKEYKGSRANELRIDDTTAQISAALMSDHGASALHLGYLTHPRPEGGKPRGEGFELRTDEHGAVRAARGLLLSTEEQLRAGAGHLDRGVVVQVLEAALELARELGDYAGEHQGVGHDAAPQQTLQEAVRDLGHGANDESGKSNGGKPAIALSGPAGIAAATPTSLTLAAGEHVDSVARQNQQVTAGQKVVINAGSDIGLFAQGGELRQITHQGPMLLQAQKNDIRLEAEQSVEVSASQQHVLVTAKEHITLMCGGAYLTLKGGNIELGMPGNFVVKAAKHSHVGAASLEAELPQFEVGETQRRFVLKQLDGQTAMPNVPYTITMANGEVIEGVTDAEGATQLLQKDAMNIAKVDMKHTRSPASAVAGIAAAVGAAVAVGKLLSGPDAEAGRALSEGEISLAKDVFGDSIDYSTVRLRDEDYVPWQGKDYVMAPNGHIYFGEELRGVADWSLESLQRQGLFIHEMTHVWQHQHGVNVLLVGAYQQARQFLLGDQYAYRLEPGKTLKDYNIEQQGDIVRDYFLEKNEFGEASANSRFAGVLKNFPTGY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9855 - -



  Protein sequence: 1020 a.a.    .

>EFF01817 NC_008463:c288272-285213 [Pseudomonas aeruginosa UCBPP-PA14]
MRQRDLKFTFVVGEGKLAFDVVEFELEEALCEPFRLNLKLASDKNAIDFKQVLDQPGTFTLWQDGRPARYVHGIVSHFTQ
GSSGFRRTRYELLLEPQLARLELCCNWRIFQEKSVPEILQALLKEHRVLDYEQRIYHEHLPREYCVQAGDSDHYLHDRLA
FEEGLVYYFRFDEHRHTLVCSDRLYVQERIAGGPVLFSAQPEGDNPQPVLHSFRYSENVRTARQTQRDYSFKRPTYDQEH
HLAGEALEHQDSSYERYDYPGRYKQSGAGRPFSESRLRGHRRDARVASVSGDDPRLIPGHAFALEGHPRADFNAWWRPVR
VVHRGTQYAGQEEESADAPLGVSYDLRAELVPEDVEWRPAPLPRPRIDGPQIATVVGPAGEEIHCDEWGRVKVQFPWDRE
GRHDEFSTCWIRVAQNWAGADWGNMAIPRIGQEVIVDYLDGDCDQPIVTGRTYRATNRPPYALPDHKILSTIKSKEYKGS
RANELRIDDTTAQISAALMSDHGASALHLGYLTHPRPEGGKPRGEGFELRTDEHGAVRAARGLLLSTEEQLRAGAGHLDR
GVVVQVLEAALELARELGDYAGEHQGVGHDAAPQQTLQEAVRDLGHGANDESGKSNGGKPAIALSGPAGIAAATPTSLTL
AAGEHVDSVARQNQQVTAGQKVVINAGSDIGLFAQGGELRQITHQGPMLLQAQKNDIRLEAEQSVEVSASQQHVLVTAKE
HITLMCGGAYLTLKGGNIELGMPGNFVVKAAKHSHVGAASLEAELPQFEVGETQRRFVLKQLDGQTAMPNVPYTITMANG
EVIEGVTDAEGATQLLQKDAMNIAKVDMKHTRSPASAVAGIAAAVGAAVAVGKLLSGPDAEAGRALSEGEISLAKDVFGD
SIDYSTVRLRDEDYVPWQGKDYVMAPNGHIYFGEELRGVADWSLESLQRQGLFIHEMTHVWQHQHGVNVLLVGAYQQARQ
FLLGDQYAYRLEPGKTLKDYNIEQQGDIVRDYFLEKNEFGEASANSRFAGVLKNFPTGY*

  Nucleotide sequence: 3060 bp    .

>EFF01817 NC_008463:c288272-285213 [Pseudomonas aeruginosa UCBPP-PA14]
ATGCGTCAAAGGGACCTGAAATTCACCTTCGTCGTCGGCGAAGGGAAACTCGCGTTCGATGTCGTCGAGTTCGAACTGGA
AGAAGCGCTCTGCGAGCCTTTCCGCCTGAACCTGAAGCTGGCCAGCGACAAGAACGCCATCGATTTCAAGCAGGTACTCG
ACCAGCCGGGCACCTTCACCCTCTGGCAGGACGGCCGTCCGGCCCGCTACGTCCATGGCATCGTCAGCCACTTCACCCAG
GGCAGCTCGGGTTTTCGCCGGACCCGCTACGAACTGCTGCTGGAACCGCAGTTGGCGCGCCTGGAGCTGTGCTGCAACTG
GCGGATCTTCCAGGAGAAGAGTGTTCCGGAGATTCTCCAGGCGCTGCTCAAGGAACACCGGGTGCTCGACTACGAACAGC
GCATCTACCATGAGCACCTGCCGCGCGAATACTGCGTGCAGGCCGGCGACAGCGATCACTACCTGCACGACCGGCTGGCT
TTCGAGGAAGGCCTGGTCTACTACTTCCGCTTCGACGAACACCGCCACACCCTGGTCTGCAGCGACCGGCTCTACGTCCA
GGAGCGTATCGCCGGCGGCCCGGTACTGTTCAGCGCCCAGCCGGAGGGCGACAACCCGCAGCCGGTGCTTCATTCCTTCC
GCTACAGCGAAAATGTTCGTACGGCTCGACAGACCCAGCGGGACTACAGCTTCAAGCGCCCGACCTACGACCAGGAGCAT
CATCTCGCTGGCGAGGCGCTCGAGCATCAGGACTCGTCCTACGAGCGCTACGACTACCCCGGTCGCTACAAGCAGAGCGG
CGCGGGCCGGCCTTTCAGCGAAAGCCGCCTCAGAGGACATCGGCGCGATGCACGGGTGGCATCGGTCAGCGGCGACGACC
CGCGGCTGATCCCGGGCCACGCCTTTGCCCTGGAAGGTCATCCGCGTGCCGACTTCAACGCCTGGTGGCGGCCGGTGCGG
GTGGTCCATCGCGGCACCCAGTATGCCGGCCAGGAGGAAGAGTCCGCCGACGCCCCTCTGGGGGTGAGCTACGACCTGCG
CGCCGAACTGGTGCCCGAGGACGTCGAATGGCGTCCCGCACCGCTGCCTCGGCCGCGTATCGATGGTCCGCAGATCGCGA
CGGTAGTCGGCCCGGCAGGGGAAGAGATCCATTGCGACGAGTGGGGGCGGGTGAAAGTCCAGTTCCCCTGGGATCGCGAG
GGACGTCACGATGAGTTCAGTACCTGCTGGATACGGGTCGCGCAGAACTGGGCGGGTGCCGACTGGGGAAACATGGCGAT
CCCGCGGATTGGCCAGGAGGTGATCGTCGATTACCTGGACGGCGACTGCGACCAGCCGATCGTCACCGGGCGCACCTACC
GGGCGACCAACCGACCACCCTACGCGCTGCCCGACCACAAGATCCTCAGCACCATCAAGAGCAAGGAGTACAAGGGCAGT
CGGGCCAACGAGCTGCGCATCGACGACACCACGGCGCAGATCAGTGCGGCGCTGATGAGCGACCACGGTGCCAGCGCGCT
GCACCTGGGCTACCTGACCCATCCTCGGCCCGAAGGCGGCAAGCCGCGCGGCGAGGGCTTCGAACTGCGCACCGACGAAC
ATGGCGCGGTGCGTGCGGCCAGGGGCCTGCTGCTGAGCACCGAGGAGCAGCTCAGGGCCGGCGCCGGCCATCTCGACCGA
GGCGTCGTGGTGCAGGTGCTGGAGGCGGCGCTGGAGCTGGCCCGCGAGCTGGGCGACTACGCCGGGGAGCACCAGGGCGT
GGGGCACGACGCGGCGCCGCAGCAAACCCTCCAGGAAGCCGTGCGCGACCTCGGCCACGGTGCCAACGACGAGTCCGGCA
AGAGCAACGGAGGCAAGCCAGCGATCGCCTTGAGCGGTCCGGCAGGGATCGCCGCGGCGACGCCGACGAGCCTGACCCTG
GCCGCCGGCGAGCACGTCGACAGCGTGGCCCGGCAGAACCAGCAGGTGACCGCCGGGCAGAAGGTGGTGATCAACGCCGG
CAGCGACATCGGCCTGTTCGCCCAGGGCGGCGAGCTGCGCCAGATCACCCACCAGGGGCCGATGCTGCTGCAGGCGCAGA
AGAACGACATCCGCCTGGAGGCCGAGCAGAGCGTGGAGGTCAGCGCCAGCCAGCAGCACGTGCTGGTCACCGCGAAGGAG
CACATCACCCTGATGTGCGGCGGCGCCTACCTGACCCTCAAGGGCGGCAACATCGAGCTGGGCATGCCCGGCAACTTCGT
GGTCAAGGCGGCGAAGCACAGTCATGTCGGCGCGGCCAGCCTGGAAGCCGAGCTGCCGCAGTTCGAGGTGGGCGAGACGC
AGCGGCGGTTCGTCCTCAAGCAACTGGACGGGCAGACGGCCATGCCCAACGTGCCCTATACCATCACCATGGCCAACGGC
GAGGTCATCGAGGGCGTCACCGACGCCGAAGGCGCCACCCAGCTGCTGCAGAAGGATGCGATGAACATCGCCAAGGTCGA
TATGAAACACACGAGATCGCCCGCCTCCGCAGTTGCCGGGATAGCAGCGGCGGTTGGCGCGGCGGTTGCAGTCGGCAAGC
TCCTGAGTGGCCCCGACGCCGAGGCCGGACGTGCTCTCAGCGAAGGGGAAATCAGCCTGGCGAAAGACGTATTCGGCGAC
TCCATCGACTATTCCACGGTCCGCCTGCGCGACGAGGACTATGTCCCCTGGCAGGGCAAGGACTACGTGATGGCGCCGAA
CGGCCACATCTACTTCGGCGAGGAGTTGCGCGGCGTGGCGGACTGGAGCCTGGAGAGCCTGCAGCGCCAGGGCCTGTTCA
TCCACGAAATGACCCATGTCTGGCAGCACCAGCATGGCGTCAACGTCCTTCTGGTGGGGGCCTACCAGCAAGCCAGGCAG
TTTCTCCTAGGCGACCAGTACGCCTACCGGTTGGAGCCGGGAAAGACGTTGAAGGACTACAACATCGAACAGCAGGGAGA
CATCGTTCGAGATTATTTCCTCGAGAAGAACGAGTTCGGGGAAGCCTCTGCGAACAGCAGGTTCGCTGGCGTACTGAAAA
ACTTCCCAACGGGATACTGA