Detailed information of effector


Summary

Effector ID EFF01816 experimental
Effector type Tde
Cognate immunity protein -
Related T6SS (Type) T6SS00150 experimental (Type i3)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (364 a.a.); Nucleotide sequence (1092 bp)
Description Tse7 encodes an N-terminal DUF4150 PAAR-like domain and a C-terminal Tox-GHH2 domain. Tse7 is a nuclease toxin with DNase activity which intoxicates E. coli and leads to growth arrest.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA14_01200 (Tse7)
Coordinates (Strand) 118146..119237 (+)
NCBI ID 489228633
RefSeq NC_008463
Uniprot ID A0A0H2ZJ41_PSEAB, A0A221KQ91_PSEAI
KEGG ID pau:PA14_01200
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4150 PF13665.8 6e-36 21..134
Tox-GHH2 PF15635.8 6.7e-11 207..275

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-363 MANEVYANNMEISCKAASGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTRTIRITRKEVMLKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPPWIYSDKQTMALHKDCEEDVQKEKTACAGKKTKAEKCADDGCKKARKCLLVSYNQGKRKSGIGCCPGEQPHHLIEAHCFYEVGKRGEGDSMFFNAPAGKQPYKDTESPCVCAEGPRHAGEHGQYHAFQQALEAKHHEKSGGWTYADARNAGVKANKAVNEQCNDKCTAAQLDSYHKERCGVTDSTPLRTDPQAGTRSVGTLDAKQTAALQAEIGAMSGMSAAGGSL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9327 - -



  Protein sequence: 364 a.a.    .

>EFF01816 NC_008463:118146-119237 [Pseudomonas aeruginosa UCBPP-PA14]
MANEVYANNMEISCKAASGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTRTIRITRKEVMLKNKSYYKTS
YGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPPWIYSDKQTMALHKDCEEDVQKE
KTACAGKKTKAEKCADDGCKKARKCLLVSYNQGKRKSGIGCCPGEQPHHLIEAHCFYEVGKRGEGDSMFFNAPAGKQPYK
DTESPCVCAEGPRHAGEHGQYHAFQQALEAKHHEKSGGWTYADARNAGVKANKAVNEQCNDKCTAAQLDSYHKERCGVTD
STPLRTDPQAGTRSVGTLDAKQTAALQAEIGAMSGMSAAGGSL*

  Nucleotide sequence: 1092 bp    .

>EFF01816 NC_008463:118146-119237 [Pseudomonas aeruginosa UCBPP-PA14]
ATGGCCAACGAGGTGTACGCCAACAACATGGAGATCTCCTGCAAGGCGGCGAGCGGCAAGTCCATCGCGGCCTTCCCGGA
TGTCTGCTTCACCCCGCCGCAGGCGCCGCCGACGCCGTTGGGGGTACCGATCCCCTACCCCAATACCGGCCTGTCCAAGG
ACACCACCAAAGGCACCCGGACCATTCGCATCACCCGCAAGGAGGTGATGCTGAAGAACAAGAGCTACTACAAGACCAGC
TACGGCGACGAGCCGGGGCGGGCGCCGAAGAAGGGCATCGTCACCAGCAAAATCAAGGGCAAGGTGTACTTCACCTCCTG
GTCGATGAACGTCAAGTTCGAAAGCAAGAACGTGGTTCGCCACCTCGACCTGACCACCCACAACCACGCGTCCTTTCCCG
GCAATACGCCACCCTGGATCTATTCCGACAAACAGACCATGGCGCTGCACAAGGATTGCGAGGAGGACGTGCAGAAGGAG
AAGACGGCTTGCGCCGGCAAGAAGACCAAGGCGGAGAAGTGCGCCGACGATGGCTGCAAGAAAGCCAGGAAATGCCTGTT
GGTTTCCTACAACCAGGGCAAGAGAAAGAGCGGCATCGGCTGCTGTCCCGGCGAACAGCCGCACCACCTGATCGAGGCGC
ATTGCTTCTACGAGGTGGGCAAGCGCGGCGAGGGCGACAGCATGTTCTTCAACGCGCCTGCGGGCAAGCAGCCGTACAAG
GACACCGAGTCGCCCTGCGTGTGCGCCGAAGGGCCCCGGCATGCGGGCGAACACGGCCAGTACCATGCCTTCCAGCAGGC
TCTGGAGGCCAAGCACCACGAGAAGTCCGGCGGCTGGACCTACGCGGATGCGCGCAACGCCGGGGTCAAGGCGAACAAGG
CGGTGAACGAACAGTGCAACGACAAGTGCACCGCGGCTCAGTTGGACAGTTATCACAAGGAACGCTGTGGGGTGACCGAC
AGCACGCCGCTCAGGACCGACCCGCAGGCGGGGACACGCTCGGTGGGTACGCTGGACGCCAAGCAAACCGCTGCCCTGCA
GGCGGAAATCGGGGCGATGAGCGGCATGTCGGCGGCCGGCGGTTCACTGTAA