Detailed information of effector


Summary

Effector ID EFF01815 experimental
Effector type Tae/Tge
Cognate immunity protein -
Related T6SS (Type) T6SS01032 insolico (Type i4b)
Strain Acinetobacter baumannii AB307-0294
Replicon chromosome
Sequence Protein sequence (583 a.a.); Nucleotide sequence (1749 bp)
Description LysM,is a predicted peptidoglycan hydrolase, within the cytoplasm of E. coli cells did not result in any cell toxicity but toxic in periplasm.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ABBFA_RS00605 (LysM)
Coordinates (Strand) 131953..133701 (+)
NCBI ID 1281361006
RefSeq NZ_CP001172
Uniprot ID A0A0D5YCA5_ACIBA
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
LysM PF01476.22 6.9e-11 113..156

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-582 MNKKGLIQFRFVELFTGNNIPNLYHVIKNEKGTTIASGMTNSNGLTVMISRDVGDTLYVYLKNIITGDLKEKVRHTVIYKKEIVRVTSSKILLDNIILAKSTNKPGNYRYLTHKVKKGENLSLISHRFNCKISEIVHLNKLKNPDHIDVGQIIKIPYKGGSSDSKKSPDNKQSKHENNKSSSTQKVNSHENNNKNTSDKPQKRIESKDITDEYTKESGKPMKVATNATSPCICKQYNLAWGSKVSCEFRKRVIKIAQNLWPNDSENMASQLMAVMHLESAGTFSPKIGTFISKKLTDDAKGGYVGLIQFGKFASIDLKVKRSDLAKMSAVQQLDYVEKYYKLNSAHTKIKNLTGLYLWVNYPKNVKENRLEDEDIVYAAPKDAEVTSKKFLESPYHQNPSFMKENEEYKRDGKKVIRQGFKNGSTKVWEVEQEIKKHLTEGIKSQNLEKNYNCAYINHTEIKNTQKINLEKFAEILRKRAKEKSQHQCAKYVRIALEAGGADTSGHPVAASDWGPTLKKIGYKEIPEEFNKPQLGDIYIITKTDKHQYGHIAGYDGSQWISDFKQKGHRIYSDHVNYRYFRM



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9821 - -



  Protein sequence: 583 a.a.    .

>EFF01815 NZ_CP001172:131953-133701 [Acinetobacter baumannii AB307-0294]
MNKKGLIQFRFVELFTGNNIPNLYHVIKNEKGTTIASGMTNSNGLTVMISRDVGDTLYVYLKNIITGDLKEKVRHTVIYK
KEIVRVTSSKILLDNIILAKSTNKPGNYRYLTHKVKKGENLSLISHRFNCKISEIVHLNKLKNPDHIDVGQIIKIPYKGG
SSDSKKSPDNKQSKHENNKSSSTQKVNSHENNNKNTSDKPQKRIESKDITDEYTKESGKPMKVATNATSPCICKQYNLAW
GSKVSCEFRKRVIKIAQNLWPNDSENMASQLMAVMHLESAGTFSPKIGTFISKKLTDDAKGGYVGLIQFGKFASIDLKVK
RSDLAKMSAVQQLDYVEKYYKLNSAHTKIKNLTGLYLWVNYPKNVKENRLEDEDIVYAAPKDAEVTSKKFLESPYHQNPS
FMKENEEYKRDGKKVIRQGFKNGSTKVWEVEQEIKKHLTEGIKSQNLEKNYNCAYINHTEIKNTQKINLEKFAEILRKRA
KEKSQHQCAKYVRIALEAGGADTSGHPVAASDWGPTLKKIGYKEIPEEFNKPQLGDIYIITKTDKHQYGHIAGYDGSQWI
SDFKQKGHRIYSDHVNYRYFRM*

  Nucleotide sequence: 1749 bp    .

>EFF01815 NZ_CP001172:131953-133701 [Acinetobacter baumannii AB307-0294]
ATGAATAAGAAAGGTTTAATTCAGTTTAGGTTTGTTGAATTATTTACTGGTAATAATATACCTAATTTATATCATGTTAT
TAAGAATGAAAAGGGCACAACTATTGCTTCTGGAATGACAAATAGTAATGGCTTAACAGTAATGATAAGTAGAGATGTAG
GCGATACTCTTTATGTATATTTAAAAAATATTATAACAGGTGATTTGAAAGAAAAAGTTAGACACACTGTTATTTATAAA
AAGGAGATAGTAAGAGTAACATCATCAAAAATACTATTAGATAATATTATCTTAGCAAAATCAACGAATAAACCTGGTAA
TTATAGATATTTAACGCATAAAGTAAAAAAAGGAGAAAACTTATCTTTAATTTCTCATCGATTTAATTGTAAAATTAGTG
AAATTGTACATTTGAATAAATTAAAAAATCCTGATCATATAGATGTCGGACAAATTATTAAAATTCCATACAAAGGTGGA
TCAAGTGATTCTAAGAAAAGTCCTGATAACAAACAATCTAAGCATGAAAATAATAAATCATCTTCTACTCAGAAAGTAAA
TTCACATGAAAATAATAATAAAAATACTTCAGATAAACCTCAAAAAAGAATAGAGTCAAAAGATATAACTGATGAATATA
CAAAAGAGTCAGGAAAACCAATGAAAGTTGCTACTAATGCAACTTCACCATGTATTTGTAAACAATATAATTTGGCTTGG
GGATCTAAAGTTAGTTGCGAATTTAGGAAAAGAGTTATAAAAATAGCACAAAATTTGTGGCCTAATGATTCAGAGAATAT
GGCAAGCCAATTAATGGCTGTTATGCATTTAGAGTCTGCCGGAACTTTTAGTCCAAAAATTGGAACTTTTATCAGCAAAA
AATTAACAGATGATGCTAAAGGTGGTTATGTTGGTCTTATCCAATTCGGAAAATTTGCTTCAATTGATTTAAAAGTTAAA
AGATCTGATTTAGCGAAAATGTCAGCTGTACAACAATTAGATTATGTAGAAAAATACTATAAATTAAACTCTGCTCATAC
AAAGATTAAAAATCTAACTGGATTATATTTATGGGTTAATTATCCTAAAAATGTCAAAGAAAACCGATTAGAAGATGAAG
ATATTGTATATGCGGCACCCAAAGACGCAGAAGTAACTTCTAAAAAATTTTTAGAAAGCCCATATCACCAAAATCCTAGT
TTTATGAAAGAGAATGAGGAATATAAACGGGATGGTAAAAAAGTTATTAGACAAGGATTTAAAAATGGTTCAACTAAAGT
TTGGGAGGTTGAACAAGAAATTAAAAAACATTTAACCGAAGGTATAAAAAGTCAAAATTTAGAGAAAAATTATAATTGTG
CATACATAAATCATACTGAGATAAAAAATACTCAGAAAATTAATTTGGAAAAATTTGCTGAAATTTTGAGAAAGAGAGCT
AAAGAAAAAAGTCAACATCAATGTGCAAAGTATGTAAGAATTGCATTAGAGGCAGGAGGAGCCGACACTTCAGGACATCC
TGTCGCAGCATCAGATTGGGGGCCAACTCTCAAAAAAATAGGTTATAAAGAAATACCTGAAGAGTTTAATAAACCTCAAT
TAGGTGATATTTATATCATCACCAAAACTGATAAGCATCAATATGGCCATATTGCAGGCTATGATGGTAGCCAATGGATT
TCTGATTTTAAACAAAAAGGTCATAGAATTTATAGCGATCATGTTAACTACAGATATTTTAGAATGTAA