Detailed information of effector


Summary

Effector ID EFF01810 experimental
Effector type Tde
Cognate immunity protein -
Related T6SS (Type) T6SS00551 experimental (Type i3)
Strain Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
Replicon chromosome
Sequence Protein sequence (174 a.a.); Nucleotide sequence (522 bp)
Description Tlde1 is an anti-bacterial effector secreted via the SPI-6 T6SS and Tlde1 Intoxication causes altered cell division, swelling, and lysis.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) STM14_0336 (Tlde1)
Coordinates (Strand) 329640..330161 (+)
NCBI ID 446891128
RefSeq NC_016856
Uniprot ID V7IRB5_SALET, M7RFX4_SALDU, A0A2R4HUU4_SALEN, A0A2T8L422_SALET, A0A0H3ND49_SALTS, A0A232R996_SALER, Q57SX4_SALCH, A0A2T9Q8Y9_SALET, A0A2R4DD94_SALET, A0A2T8MP53_SALAN, A0A0F6AX90_SALT1, A0A2T6X0K3_SALET, A0A265B9N8_SALET, H9L4J5_SALTM, E8XIV3_SALT4, Q93IR4_SALTY
KEGG ID seo:STM14_0336, sey:SL1344_0283, seb:STM474_0300, sec:SCH_0281, stm:STM0288
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF2778 PF10908.10 1.7e-05 34..151

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-173 MMAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPEGNYKLFIQFQGEAPIRNAADCDLGPSWGWSTIPRGQAAGTCEIYWANWGYNRIRLESADEKTRKACGGKRGGFYIHDSTKGYSHGCIEVEPVFFRILKQETEKENGEKTFTVNVKYVSGQQTNGGTKQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9595 - -



  Protein sequence: 174 a.a.    .

>EFF01810 NC_016856:329640-330161 [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
MMAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPEGNYKLFIQFQGEAPIRNAADCDLGPSWGWSTIPRG
QAAGTCEIYWANWGYNRIRLESADEKTRKACGGKRGGFYIHDSTKGYSHGCIEVEPVFFRILKQETEKENGEKTFTVNVK
YVSGQQTNGGTKQ*

  Nucleotide sequence: 522 bp    .

>EFF01810 NC_016856:329640-330161 [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
ATGATGGCAGTAAGACTGACTTTTGACGGGCAAAAGCTGACATGGCCTGGTATCGGGATATTTAAGGCGACCACGGGGTT
ACCGGATTTACAGTGGCCAGATAAACAGTGTGTGCCGGATGCGGCGATACCGGAAGGGAATTATAAATTGTTTATTCAGT
TTCAGGGGGAGGCACCGATAAGAAATGCTGCGGATTGTGATCTGGGACCATCATGGGGCTGGAGTACCATTCCGCGAGGC
CAGGCTGCCGGAACATGTGAGATATACTGGGCGAACTGGGGATATAATCGTATCCGGCTGGAATCAGCGGATGAGAAGAC
CCGAAAAGCCTGTGGGGGCAAGCGGGGTGGTTTTTATATCCATGATTCCACCAAAGGTTACAGTCATGGTTGTATTGAAG
TGGAACCGGTGTTTTTCCGTATTCTGAAACAGGAGACGGAAAAAGAAAATGGTGAAAAGACATTTACGGTTAATGTTAAG
TATGTTTCTGGTCAGCAAACGAATGGTGGAACAAAACAATAA