Detailed information of effector


Summary

Effector ID EFF01803 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00061 experimental (Type i4b)
Strain Acinetobacter baylyi ADP1
Replicon chromosome
Sequence Protein sequence (530 a.a.); Nucleotide sequence (1590 bp)
Description Tse
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ACIAD_RS08275
Coordinates (Strand) 1800850..1802439 (+)
NCBI ID 491065249
RefSeq NC_005966
Uniprot ID UPI0002D01811
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-336 MEDWLEAQAQKILSYGKTEIEPIIKFYIEWLKSDTLLNYMENAFDHKSPFSASNFITINSRIVGNADTLELCSKYFAELLQEANYSNRKNYLLRTFIFDSKSLQDTVNSVNDFLGKNQITTLAFAGTQFFDESSITQHDNYKEQVKTIKESIKVKIDIFSEQIGGTVARVFHGRANQTPDAAKTVAMKSFEVFSGKTLTTKAYAGKLTDIIQQIMRDSPINFDEAESRQAKKNAKNAFKVNLKKALLENFNTDIDFHRLGKMRTKVYMVLHLDTQQLAKINPNMTQAQISEAMHGAVRGSGQVVADNKVAGALEQSRQLNQLEGQSQKVFARQGTG
Transmembrane helix 337-359 FGFGVFAFGLQSLALISATQGVA
Outside 360-363 TGVN
Transmembrane helix 364-382 VQTGMNFVGVIAATLGNVA
Inside 383-407 DVMDRQLHMKIAQIGETAKLTFLKG
Transmembrane helix 408-430 WAKRIAIGGLYGGAILLAAVEVL
Outside 431-439 KGNDALKKD
Transmembrane helix 440-462 QYFIMASYYVNAVVIFFTTRAFI
Inside 463-468 NSSTML
Transmembrane helix 469-491 LGLRGGYWGLILIGVSIVISYGI
Outside 492-529 DLLKEREIRNFLEASGWGTKSENWTQALEKTEFEKIYE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9957 - -



  Protein sequence: 530 a.a.    .

>EFF01803 NC_005966:1800850-1802439 [Acinetobacter baylyi ADP1]
MEDWLEAQAQKILSYGKTEIEPIIKFYIEWLKSDTLLNYMENAFDHKSPFSASNFITINSRIVGNADTLELCSKYFAELL
QEANYSNRKNYLLRTFIFDSKSLQDTVNSVNDFLGKNQITTLAFAGTQFFDESSITQHDNYKEQVKTIKESIKVKIDIFS
EQIGGTVARVFHGRANQTPDAAKTVAMKSFEVFSGKTLTTKAYAGKLTDIIQQIMRDSPINFDEAESRQAKKNAKNAFKV
NLKKALLENFNTDIDFHRLGKMRTKVYMVLHLDTQQLAKINPNMTQAQISEAMHGAVRGSGQVVADNKVAGALEQSRQLN
QLEGQSQKVFARQGTGFGFGVFAFGLQSLALISATQGVATGVNVQTGMNFVGVIAATLGNVADVMDRQLHMKIAQIGETA
KLTFLKGWAKRIAIGGLYGGAILLAAVEVLKGNDALKKDQYFIMASYYVNAVVIFFTTRAFINSSTMLLGLRGGYWGLIL
IGVSIVISYGIDLLKEREIRNFLEASGWGTKSENWTQALEKTEFEKIYE*

  Nucleotide sequence: 1590 bp    .

>EFF01803 NC_005966:1800850-1802439 [Acinetobacter baylyi ADP1]
ATGGAGGATTGGCTAGAGGCGCAAGCACAAAAGATACTCAGCTATGGTAAAACAGAAATTGAGCCAATCATCAAATTTTA
TATTGAGTGGCTTAAGTCAGATACTTTATTGAACTACATGGAGAATGCTTTTGATCATAAAAGTCCATTTTCTGCGAGTA
ATTTTATAACGATTAACTCCCGAATTGTTGGTAATGCGGATACCCTAGAACTATGTTCGAAATATTTTGCAGAGTTGTTA
CAGGAGGCGAATTATAGCAATCGGAAGAATTATCTGCTGAGAACTTTTATCTTTGATTCTAAATCTTTGCAGGATACCGT
GAACTCGGTGAATGATTTTTTAGGTAAAAATCAGATCACGACTTTAGCATTTGCCGGAACACAATTTTTTGATGAGAGTA
GTATTACGCAGCATGACAATTATAAAGAACAAGTTAAAACGATTAAAGAAAGCATTAAAGTAAAAATTGATATTTTTTCC
GAACAAATCGGTGGCACAGTGGCACGTGTATTTCATGGGCGTGCTAATCAAACCCCAGATGCCGCCAAAACAGTGGCAAT
GAAAAGCTTTGAGGTGTTTTCTGGGAAAACATTAACAACAAAAGCATATGCCGGAAAGTTAACCGATATTATTCAGCAAA
TTATGCGCGATTCGCCTATTAACTTTGATGAGGCTGAATCTCGACAAGCCAAGAAAAACGCTAAAAATGCCTTTAAAGTT
AATTTAAAAAAAGCATTACTGGAAAATTTTAATACAGACATAGATTTTCACCGTTTAGGAAAAATGCGGACCAAAGTTTA
TATGGTCTTGCATCTGGATACTCAACAGTTAGCCAAGATTAATCCCAATATGACTCAGGCTCAAATCAGTGAAGCCATGC
ATGGAGCAGTGCGAGGTTCTGGACAAGTTGTAGCAGATAATAAAGTTGCTGGTGCTTTGGAGCAAAGTAGACAATTAAAC
CAGTTAGAGGGGCAAAGCCAAAAAGTTTTTGCTCGGCAAGGTACGGGTTTTGGTTTTGGTGTATTTGCGTTTGGTTTACA
GTCGTTGGCATTAATTAGTGCAACGCAAGGGGTGGCAACGGGTGTTAATGTACAAACAGGGATGAACTTTGTTGGGGTAA
TTGCGGCTACTCTAGGTAATGTTGCTGATGTGATGGATCGACAATTACACATGAAGATAGCGCAGATTGGGGAAACGGCT
AAATTAACTTTTTTAAAAGGTTGGGCTAAGAGAATTGCTATAGGTGGTTTGTATGGAGGGGCAATACTTTTAGCTGCTGT
TGAGGTACTGAAAGGAAATGATGCATTAAAGAAAGATCAATACTTCATTATGGCGTCATATTATGTAAATGCTGTTGTGA
TTTTTTTCACAACTCGTGCTTTTATTAATAGTAGTACCATGCTTCTGGGTTTACGTGGCGGTTATTGGGGGTTAATTTTA
ATTGGTGTTTCGATTGTTATTAGTTATGGCATTGACCTGTTGAAAGAAAGAGAAATACGTAATTTTCTGGAAGCATCAGG
ATGGGGAACAAAGAGTGAAAATTGGACCCAAGCCCTCGAAAAAACTGAATTTGAAAAGATTTACGAGTAA