Detailed information of effector


Summary

Effector ID EFF01800 experimental
Effector type Tde
Cognate immunity protein -
Related T6SS (Type) T6SS00945 experimental (Type i1)
Strain Vibrio proteolyticus NBRC 13287
Replicon chromosome
Sequence Protein sequence (257 a.a.); Nucleotide sequence (771 bp)
Description Tde
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VPR01S_RS21945
Coordinates (Strand) 229175..229945 (-)
NCBI ID 545468119
RefSeq NZ_BATJ01000004
Uniprot ID U2ZYX6_VIBPR
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AHH PF14412.8 5e-14 44..160

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-256 MSDTMELEEPIKGNITKKPEPGAPDYRKAWIANVNKYNDKVKPHPFCHGIQMDTHHLISEKALEKCDKALQESLVDKGYNMNSLENLVGIPATFRGACHLGTQVHRSDHKFKKNQFDEILNYDYHETIKDLVTEKKQDINECYGTTATEESERYIHKEIMDKVSQKALRRISSFALPLTSIHTNFQRPQDPQDPQDPQDPYIGCGEGEKVGEVKGGKNCCANKGNHNGEIDTRPGSDFTLDSAINFPQEWDLTRRI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9835 - -



  Protein sequence: 257 a.a.    .

>EFF01800 NZ_BATJ01000004:c229945-229175 [Vibrio proteolyticus NBRC 13287]
MSDTMELEEPIKGNITKKPEPGAPDYRKAWIANVNKYNDKVKPHPFCHGIQMDTHHLISEKALEKCDKALQESLVDKGYN
MNSLENLVGIPATFRGACHLGTQVHRSDHKFKKNQFDEILNYDYHETIKDLVTEKKQDINECYGTTATEESERYIHKEIM
DKVSQKALRRISSFALPLTSIHTNFQRPQDPQDPQDPQDPYIGCGEGEKVGEVKGGKNCCANKGNHNGEIDTRPGSDFTL
DSAINFPQEWDLTRRI*

  Nucleotide sequence: 771 bp    .

>EFF01800 NZ_BATJ01000004:c229945-229175 [Vibrio proteolyticus NBRC 13287]
ATGTCAGACACAATGGAATTAGAAGAGCCCATTAAAGGTAACATTACCAAAAAACCTGAGCCCGGCGCGCCTGATTACCG
CAAAGCTTGGATTGCGAATGTTAATAAGTACAACGATAAAGTGAAGCCGCACCCTTTTTGTCATGGTATCCAAATGGATA
CACACCACCTTATATCTGAGAAAGCACTAGAAAAGTGTGATAAGGCATTGCAAGAGAGCTTGGTTGATAAAGGTTACAAT
ATGAATAGTCTAGAGAACTTAGTTGGAATTCCTGCGACATTTAGAGGGGCTTGTCATTTAGGTACTCAAGTTCATAGGAG
TGATCATAAGTTTAAGAAAAATCAATTTGATGAGATTTTGAATTATGATTACCATGAAACAATCAAGGACTTAGTTACTG
AAAAAAAACAAGACATCAATGAATGTTACGGTACTACAGCTACCGAAGAGAGCGAGCGATACATTCACAAAGAAATTATG
GATAAAGTTAGTCAAAAGGCTTTGAGAAGGATTAGTAGCTTTGCTCTGCCACTAACTTCTATACATACAAACTTTCAACG
CCCCCAAGACCCCCAAGACCCCCAAGACCCCCAAGACCCATATATTGGGTGCGGTGAAGGTGAAAAAGTTGGTGAGGTCA
AAGGTGGTAAAAATTGTTGTGCTAATAAAGGAAATCACAATGGTGAGATTGATACCAGACCAGGCAGCGATTTTACCTTA
GATAGTGCTATAAACTTTCCACAAGAATGGGATTTGACGAGAAGAATATGA