Detailed information of effector


Summary

Effector ID EFF01537 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00939 experimental (Type i5)
Strain Vibrio alginolyticus 12G01
Replicon chromosome
Sequence Protein sequence (612 a.a.); Nucleotide sequence (1836 bp)
Description VgrG2
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) V12G01_07588 (VgrG2)
Coordinates (Strand) 1464869..1466704 (+)
NCBI ID 491518337
RefSeq NZ_CH902589
Uniprot ID UPI0000D53FE9
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 2.8e-70 30..334
Phage_base_V PF04717.14 1.3e-17 381..461

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-611 MKRATQDNNFIRISSPFGKDAIILNSFEYREEISELFSLRAKAYFNDQRSELNEIIGKEVTITLENNEDVSSNPRYMHGYVSAARLEGKRVSNTHKGENYKNIELLIEPKLRFAEYRKNCRIFQHKDIKEIISEVLSEHSVAFSFELTKSYPKYTYKVQYEESDLEFVRRLLSEEGLSFCFTHTKSAHTLNIFDDISFYKPGTEFLVDFDTGTAKSSHISSWHETQILTTKASQKSGYNMLKPSSNPKNTAKGESDFFTVPGSEYFEYMGEMESNDQYALRNTHAIEALQQNAYLCRGEATCRTFSVGKCFKFKKHEDKSRVGKEYVLSSVFLSAAVYNQTGQGGTGAQGVKVSFSCVDSKTILRPSVNYPKPQMKGLQTAVVTGNKDGEIYIDKHGRIKVQFHWDRVGKYDVNSSCWIRVAQNIAGNGWGSVFHPRVGQEVIVEFVNGDPDQPIVTGSLYNGSQLPPYALPEQSSQSGYKSRSVQKGTSNFNELRFDDKPGEEHIYLHAEKLFQMLVEDCVDIAVENSKTEKVTNDVNQEVGQNASLKVGKNFSNETGEVLSFNAGKSVEIKVGGASIQMSSSGEINIKGNKISINGSAIALKAGQISLN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9934 - -



  Protein sequence: 612 a.a.    .

>EFF01537 NZ_CH902589:1464869-1466704 [Vibrio alginolyticus 12G01]
MKRATQDNNFIRISSPFGKDAIILNSFEYREEISELFSLRAKAYFNDQRSELNEIIGKEVTITLENNEDVSSNPRYMHGY
VSAARLEGKRVSNTHKGENYKNIELLIEPKLRFAEYRKNCRIFQHKDIKEIISEVLSEHSVAFSFELTKSYPKYTYKVQY
EESDLEFVRRLLSEEGLSFCFTHTKSAHTLNIFDDISFYKPGTEFLVDFDTGTAKSSHISSWHETQILTTKASQKSGYNM
LKPSSNPKNTAKGESDFFTVPGSEYFEYMGEMESNDQYALRNTHAIEALQQNAYLCRGEATCRTFSVGKCFKFKKHEDKS
RVGKEYVLSSVFLSAAVYNQTGQGGTGAQGVKVSFSCVDSKTILRPSVNYPKPQMKGLQTAVVTGNKDGEIYIDKHGRIK
VQFHWDRVGKYDVNSSCWIRVAQNIAGNGWGSVFHPRVGQEVIVEFVNGDPDQPIVTGSLYNGSQLPPYALPEQSSQSGY
KSRSVQKGTSNFNELRFDDKPGEEHIYLHAEKLFQMLVEDCVDIAVENSKTEKVTNDVNQEVGQNASLKVGKNFSNETGE
VLSFNAGKSVEIKVGGASIQMSSSGEINIKGNKISINGSAIALKAGQISLN*

  Nucleotide sequence: 1836 bp    .

>EFF01537 NZ_CH902589:1464869-1466704 [Vibrio alginolyticus 12G01]
ATGAAAAGAGCAACTCAAGATAACAATTTCATCCGAATTTCTTCGCCATTCGGTAAAGATGCCATCATACTAAACTCGTT
TGAGTATAGAGAAGAGATCTCAGAACTTTTTTCATTGCGTGCTAAAGCTTACTTTAATGATCAACGAAGTGAGTTAAACG
AAATTATTGGTAAGGAAGTTACCATTACCCTTGAAAATAATGAGGATGTTTCTTCAAATCCTCGTTATATGCATGGTTAT
GTTTCTGCTGCAAGATTAGAAGGGAAAAGGGTTTCTAATACACATAAAGGCGAAAATTATAAAAACATAGAATTATTAAT
AGAGCCTAAATTACGTTTCGCTGAATATCGAAAAAATTGCAGAATATTTCAGCATAAAGATATAAAGGAAATTATCTCTG
AAGTACTATCGGAGCATAGTGTTGCCTTTAGTTTTGAGTTAACCAAGTCCTATCCTAAATACACATACAAAGTACAATAT
GAAGAATCAGATCTTGAATTTGTTCGACGTCTGTTATCGGAGGAGGGGCTATCATTTTGTTTTACACATACTAAGTCTGC
CCATACGCTCAATATTTTTGATGACATCAGTTTTTATAAGCCGGGTACTGAGTTTTTAGTCGATTTTGATACAGGTACGG
CGAAATCTAGCCACATTTCTTCTTGGCATGAAACGCAAATTCTGACTACTAAAGCGAGTCAAAAGTCAGGCTATAACATG
CTCAAGCCTTCTTCGAATCCTAAAAATACTGCAAAGGGTGAAAGTGATTTTTTTACAGTACCTGGAAGCGAGTATTTTGA
ATACATGGGTGAAATGGAGAGCAATGATCAATACGCACTGAGAAACACGCATGCAATAGAAGCACTACAGCAAAATGCAT
ATTTGTGTCGTGGCGAGGCTACGTGCAGAACATTCAGTGTGGGCAAGTGCTTCAAGTTTAAAAAGCATGAAGATAAATCT
CGAGTCGGCAAAGAATATGTACTGTCTTCTGTTTTTTTGTCTGCTGCTGTTTATAACCAGACTGGTCAAGGTGGGACCGG
TGCGCAAGGTGTCAAAGTCTCGTTTAGTTGTGTTGACTCAAAGACAATCCTGCGTCCTTCAGTTAACTACCCGAAACCTC
AGATGAAAGGTTTGCAAACCGCAGTAGTTACGGGGAACAAAGATGGTGAAATTTACATAGACAAACATGGCCGTATCAAA
GTTCAGTTTCACTGGGACCGTGTTGGTAAATACGATGTAAATAGTTCATGTTGGATTCGTGTTGCGCAAAATATTGCAGG
TAACGGATGGGGGTCGGTGTTTCACCCTAGAGTCGGACAAGAGGTCATCGTCGAGTTTGTTAACGGAGACCCTGATCAAC
CAATCGTTACGGGGTCACTATATAACGGTAGTCAACTCCCTCCTTACGCTTTACCAGAGCAAAGTTCTCAGAGTGGTTAT
AAATCACGCTCTGTACAAAAAGGTACATCCAATTTTAATGAGTTGCGCTTCGATGATAAGCCTGGTGAAGAGCACATTTA
TCTTCATGCTGAAAAACTGTTCCAAATGCTAGTTGAAGACTGTGTTGATATCGCCGTTGAAAACAGTAAAACCGAAAAAG
TGACCAATGATGTTAATCAAGAGGTTGGTCAGAACGCGAGCTTGAAAGTAGGTAAAAACTTTTCGAATGAAACGGGTGAA
GTACTGTCTTTTAATGCAGGAAAGAGCGTCGAGATCAAAGTAGGTGGTGCTTCTATTCAGATGTCTAGCTCTGGAGAAAT
CAATATCAAAGGTAATAAAATATCCATTAACGGCTCAGCTATTGCTCTTAAAGCTGGGCAAATTTCATTGAACTAA