Detailed information of effector


Summary

Effector ID EFF01536 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00939 experimental (Type i5)
Strain Vibrio alginolyticus 12G01
Replicon chromosome
Sequence Protein sequence (486 a.a.); Nucleotide sequence (1458 bp)
Description PAAR1
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) V12G01_01440 (PAAR)
Coordinates (Strand) 100481..101938 (-)
NCBI ID 491515718
RefSeq NZ_CH902589
Uniprot ID UPI0000D54591
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4150 PF13665.8 1.1e-35 22..127

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-485 MGVTVGANGLSIVHKGSGGEANATLPDVCLTKVGKPVVPIPYGNNAKSADLAGGTTTVSMDGGNSVAIKGSTFSKSTGDAGGDRKGVASGTIEAEAKFISASPTVKFEGKGVCRLSDQMTMNKANTVCLGGAQNPSVSVSEEQEGTYTLDIECKYPNGLPYSNAQFSLVEPSGAVIGSGVLDSSGKASVNGLALKECKLVLSETQDSYTPNQSLAENIVTETYPDPNDFCTFVAGRRSPFWEDRVGVANDWGILMSPSFSDDDFKDIVLEQSRISSPYAISQNHSKDFSDAYVSALYHIQTDTTALEKYEPLVELLLEQVHENGDILRVLYQADVFEPPYELLAKLRFLGTGNTVKYLQFVLWTLINNQICSYIDELNSEIIGRLDFIQSQASARSLSSVEEGINGYKKALNHFKQALPDVISQIFETKNDTLISISAMALGSTVNIASQSSFATNLGRVNAVVYTKSNNLNRPSFVTFDDNFSD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7758 - -



  Protein sequence: 486 a.a.    .

>EFF01536 NZ_CH902589:c101938-100481 [Vibrio alginolyticus 12G01]
MGVTVGANGLSIVHKGSGGEANATLPDVCLTKVGKPVVPIPYGNNAKSADLAGGTTTVSMDGGNSVAIKGSTFSKSTGDA
GGDRKGVASGTIEAEAKFISASPTVKFEGKGVCRLSDQMTMNKANTVCLGGAQNPSVSVSEEQEGTYTLDIECKYPNGLP
YSNAQFSLVEPSGAVIGSGVLDSSGKASVNGLALKECKLVLSETQDSYTPNQSLAENIVTETYPDPNDFCTFVAGRRSPF
WEDRVGVANDWGILMSPSFSDDDFKDIVLEQSRISSPYAISQNHSKDFSDAYVSALYHIQTDTTALEKYEPLVELLLEQV
HENGDILRVLYQADVFEPPYELLAKLRFLGTGNTVKYLQFVLWTLINNQICSYIDELNSEIIGRLDFIQSQASARSLSSV
EEGINGYKKALNHFKQALPDVISQIFETKNDTLISISAMALGSTVNIASQSSFATNLGRVNAVVYTKSNNLNRPSFVTFD
DNFSD*

  Nucleotide sequence: 1458 bp    .

>EFF01536 NZ_CH902589:c101938-100481 [Vibrio alginolyticus 12G01]
ATGGGCGTAACAGTTGGTGCGAATGGACTTTCGATAGTTCATAAAGGCTCAGGTGGTGAAGCGAATGCAACGCTCCCAGA
TGTTTGTTTAACTAAGGTCGGCAAGCCAGTCGTTCCTATCCCTTATGGCAACAATGCTAAATCAGCAGACCTTGCAGGTG
GGACTACGACAGTCTCTATGGATGGCGGTAACAGTGTCGCTATCAAGGGCAGTACGTTCTCAAAAAGTACCGGCGATGCG
GGCGGTGACAGAAAAGGCGTTGCCTCAGGCACGATAGAAGCCGAAGCAAAATTCATTTCAGCTTCACCAACGGTTAAGTT
TGAAGGTAAGGGCGTATGTCGCCTGTCCGATCAAATGACCATGAATAAAGCCAACACTGTGTGTCTTGGCGGCGCACAAA
ACCCATCGGTTTCTGTGAGTGAAGAGCAGGAAGGGACGTATACGCTGGATATAGAATGCAAATATCCAAATGGGCTCCCT
TACTCTAATGCACAATTTTCTTTAGTCGAACCTTCAGGTGCTGTCATTGGGAGTGGAGTGCTGGATTCTAGCGGAAAAGC
ATCTGTTAATGGTCTCGCTCTAAAAGAATGCAAGTTAGTGCTCAGTGAAACTCAAGACTCTTACACCCCGAACCAATCTT
TAGCTGAAAATATTGTGACGGAAACTTACCCTGATCCGAATGATTTTTGTACGTTTGTCGCAGGTCGCCGCTCACCATTT
TGGGAAGATCGTGTTGGGGTTGCTAATGACTGGGGGATATTGATGTCCCCATCCTTCAGTGATGATGACTTTAAAGACAT
TGTGTTAGAGCAAAGCCGTATATCGTCTCCTTATGCGATTAGTCAAAATCACTCTAAAGACTTTTCTGATGCTTATGTTT
CGGCACTTTATCACATCCAAACTGATACTACTGCGCTAGAGAAATATGAACCTTTAGTTGAACTGCTCTTGGAGCAAGTG
CACGAAAATGGCGATATATTGAGAGTCTTATATCAAGCTGATGTGTTTGAGCCTCCCTATGAATTATTAGCGAAGCTTCG
CTTTTTAGGGACTGGGAATACTGTGAAGTATTTGCAGTTTGTTTTATGGACGTTGATAAACAATCAAATCTGTTCATACA
TCGATGAGCTAAACAGTGAAATCATCGGTCGTTTAGATTTCATACAAAGCCAAGCTTCTGCAAGATCGTTGAGTTCTGTT
GAAGAGGGTATAAACGGTTATAAAAAAGCACTTAACCACTTCAAACAAGCACTTCCTGACGTCATTAGCCAAATTTTCGA
AACCAAAAATGACACCCTAATTTCTATATCGGCAATGGCCCTTGGGAGTACCGTTAACATAGCGAGCCAATCTAGCTTTG
CTACTAATTTAGGTAGGGTTAATGCGGTGGTGTACACGAAGTCAAACAACTTGAACCGCCCATCATTTGTCACTTTTGAC
GATAACTTTTCTGACTAG