Detailed information of effector


Summary

Effector ID EFF01534 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00939 experimental (Type i5)
Strain Vibrio alginolyticus 12G01
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) V12G01_01540 (hcp1)
Coordinates (Strand) 127580..128098 (-)
NCBI ID 491515782
RefSeq NZ_CH902589
Uniprot ID A0A2I3CPL0_VIBAX, A7JYI0_VIBAE, A0A0T7DYZ2_9VIBR, B1PDM0_VIBAL
KEGG ID vag:N646_3978
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 6.4e-31 6..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MPTPAYMSIQGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVVTKVQDRSSPLLFNALVSGEKLPECVIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVTEEVLKFTYRAIEVTHENCGTAGNDDWRAPREA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9660 - -



  Protein sequence: 173 a.a.    .

>EFF01534 NZ_CH902589:c128098-127580 [Vibrio alginolyticus 12G01]
MPTPAYMSIQGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVVTKVQDRSSPL
LFNALVSGEKLPECVIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVTEEVLKFTYRAIEVTHENCGT
AGNDDWRAPREA*

  Nucleotide sequence: 519 bp    .

>EFF01534 NZ_CH902589:c128098-127580 [Vibrio alginolyticus 12G01]
ATGCCAACTCCAGCATATATGTCTATCCAAGGTGAGACTCAAGGCCATATTACTAAAGATACTTACTCTGCAGATTCAGT
AGGTAACACATGGCAAGAAGCTCACGTTGATGAGTTCCTAGTACAAGAACTTGATCACGTGCTAACAGTTCCACGTGATC
CACAAAGTGGTCAGCCAACTGGTCAACGTGTACACCGTCCACTTGTTGTAACTAAAGTTCAAGATCGCTCATCTCCACTA
CTATTCAACGCACTAGTATCTGGCGAAAAACTTCCTGAGTGTGTGATCCGCTTCTACCGCACTTCAGTTCAAGGTAAACA
AGAGCACTACTACTCAATCAAATTGATTGATGCGCTACTTGTCGATATCCAAACTCGTATGAACCACTGTCAAGACGCAG
CAACAGCTGACCGCGTGACAGAAGAAGTGCTTAAGTTCACTTACCGTGCGATCGAAGTAACTCACGAAAACTGTGGTACT
GCGGGTAACGACGACTGGCGTGCTCCACGCGAAGCTTAA