Detailed information of effector


Summary

Effector ID EFF01531 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00947 experimental (Type Unknown)
Strain Escherichia coli strain PE050
Replicon chromosome
Sequence Protein sequence (150 a.a.); Nucleotide sequence (450 bp)
Description ETEC PE050 cells deploy VT1 by T6SS to inhibit other cells and protect themselves with immunity protein VTI1.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) vt6C (VTI1)
Coordinates (Strand) 3177..3626 (+)
NCBI ID 1062685204
GenBank KX118292
Uniprot ID UPI0002B54B26
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-149 MFMNMIKLVIKQKVKALISIVLINFFFCSNSYSEEKIEIININKPIYIGTNQSDKVLITACNHWVLNSRDIIDIFNLSIKHDDYGEINRMYYWLPCEIRGRLMYDGIEWSFVINAAATAMWMSNDKEIYWGCNKKACDNFFLLPYDGMR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.6052 pos: 33-34. SYS-EE. MFMNMIKLVIKQKVKALISIVLINFFFCSNSYS



  Protein sequence: 150 a.a.    .

>EFF01531 KX118292:3177-3626 [Escherichia coli]
MFMNMIKLVIKQKVKALISIVLINFFFCSNSYSEEKIEIININKPIYIGTNQSDKVLITACNHWVLNSRDIIDIFNLSIK
HDDYGEINRMYYWLPCEIRGRLMYDGIEWSFVINAAATAMWMSNDKEIYWGCNKKACDNFFLLPYDGMR*

  Nucleotide sequence: 450 bp    .

>EFF01531 KX118292:3177-3626 [Escherichia coli]
ATGTTTATGAACATGATAAAATTAGTTATAAAACAGAAGGTGAAGGCGCTGATCTCTATAGTGTTAATTAATTTCTTTTT
TTGTTCAAATAGTTACTCCGAAGAAAAAATAGAGATAATAAACATTAATAAACCAATATATATAGGTACCAATCAATCAG
ATAAGGTGCTTATTACTGCGTGTAATCATTGGGTGCTTAATTCTAGAGATATTATAGACATATTCAATCTAAGTATAAAG
CATGATGATTATGGCGAAATAAACAGAATGTATTATTGGTTACCTTGTGAAATTAGAGGGAGACTAATGTATGACGGAAT
AGAATGGAGTTTTGTTATCAATGCTGCTGCAACAGCAATGTGGATGAGCAATGATAAAGAGATTTACTGGGGATGCAATA
AAAAAGCATGCGATAATTTCTTTTTATTACCATATGATGGGATGAGGTAA