Detailed information of effector


Summary

Effector ID EFF01526 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00946 experimental (Type Unknown)
Strain Escherichia coli strain PE117
Replicon chromosome
Sequence Protein sequence (184 a.a.); Nucleotide sequence (552 bp)
Description The complementation of vti5 in Δvt5Δvti5 provided effective protection against growth inhibition by vti1+ Wt-PE171 strains.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) vt4B (VT5)
Coordinates (Strand) 3140..3691 (+)
NCBI ID 1062685231
GenBank KX118293
Uniprot ID A0A1X9VAW9_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-183 MRIMLILLCFFSFPCFSGDKIKIVKTCQLKKNESVQLLSLRTIDGDTLYLKFRNVITGAFLDTPTKSYDFFGDVVLSQCINGSLIFALEYGSPYIKGCLVTGWENGFKGKNSPEGFCFAERNIPEAVWFGKNNILIIIRNQMDVGTWKGKYIIYDNAKKSGERAYSSDNLPSKDGYIIFALNK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.6332 pos: 14-15. SFP-CF. MRIMLILLCFFSFP



  Protein sequence: 184 a.a.    .

>EFF01526 KX118293:3140-3691 [Escherichia coli]
MRIMLILLCFFSFPCFSGDKIKIVKTCQLKKNESVQLLSLRTIDGDTLYLKFRNVITGAFLDTPTKSYDFFGDVVLSQCI
NGSLIFALEYGSPYIKGCLVTGWENGFKGKNSPEGFCFAERNIPEAVWFGKNNILIIIRNQMDVGTWKGKYIIYDNAKKS
GERAYSSDNLPSKDGYIIFALNK*

  Nucleotide sequence: 552 bp    .

>EFF01526 KX118293:3140-3691 [Escherichia coli]
ATGCGCATTATGTTAATATTACTTTGTTTTTTTTCTTTCCCCTGTTTTTCAGGCGATAAGATTAAAATCGTGAAAACCTG
TCAACTGAAAAAAAATGAAAGTGTGCAGTTGCTTTCCCTTAGAACCATTGACGGTGATACATTATATCTAAAATTCAGAA
ATGTTATCACCGGGGCCTTTTTAGATACTCCAACTAAAAGTTATGATTTTTTTGGAGATGTGGTTCTTTCTCAGTGCATA
AATGGTTCTCTTATCTTTGCGCTGGAATATGGTTCTCCATATATAAAAGGTTGTCTGGTAACTGGTTGGGAAAATGGGTT
TAAAGGTAAGAACTCTCCTGAAGGCTTTTGTTTCGCAGAGAGAAATATTCCCGAAGCGGTATGGTTTGGAAAAAACAATA
TTTTAATTATCATCCGAAACCAAATGGATGTTGGGACATGGAAAGGGAAATATATTATCTATGATAATGCGAAAAAGTCA
GGAGAAAGAGCATACTCATCAGATAATCTACCATCAAAAGATGGTTACATAATTTTTGCATTAAATAAATAA