Detailed information of effector


Summary

Effector ID EFF01524 experimental
Effector type DddA
Cognate immunity protein -
Related T6SS (Type) T6SS00945 experimental (Type i1)
Strain Vibrio proteolyticus NBRC 13287
Replicon chromosome
Sequence Protein sequence (604 a.a.); Nucleotide sequence (1812 bp)
Description MIX‐effector Vpr01570 that contains a CNF1 toxin domain witch are deamidases that target and activate Rho GTPases. MIX‐effector Vpr01570 that contains a CNF1 toxin domain and set out to monitor its functionality.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VPR01S_11_01570
Coordinates (Strand) 161248..163059 (+)
NCBI ID 543441460
GenBank BATJ01000011
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
CNF1 PF05785.14 2.1e-20 398..560

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-603 MPNTKKTAARFVAAYYPPVETPQSKCLPTRETVREKPQPSARFQCVLRIYTAEDELSQYSVGRGQWKLLTNTKGVAPLANWEVSSQDDGTTLLTASCHKEASRRLVYEWIRGAGYGKQYEVMTRPKGSSDINAQFVPVKLALLRDGVAGWPTQGYFYHFIDGALQAECQIAGEGRWSYQLLCSDERGLDERPLFERHLSHFLLPYRIENHSPGEQYLLYRRERLSTEEWASLSSSWLAQHGLRLNMDAVIAAFNGPLTTEVRQEDIPPSGHLRVGHVYPFGDVWGQYRHPELAPELVHIQTDSSVNQRMPVVMVGEWDGEGYSTGEQVSMTQLTGRGPFYLKTPRAPRAKFWFSRIDQRAEFSAEKASERLSDSDQRDVLECSDGTQMTSFNKSMNAWVTHFWDDNPLPEELDVLVLHNGYTGAAGVRIDLDELDPGQQILVTGGTLSGCTMVTGVKGRQFYALHAGTAISPNEWKTGQHGVRDNYALLKLMMPENDLTAPPEWDNDGMPALLDCFSQATMAYSGKPEAKMQRADARCFNYYRPEILYSVCCSFSLIKKDRHGNVSVETLTELGEISQDSSAENKSVSNFVYEARDTRVKVLL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9715 - -



  Protein sequence: 604 a.a.    .

>EFF01524 BATJ01000011:161248-163059 [Vibrio proteolyticus NBRC 13287]
MPNTKKTAARFVAAYYPPVETPQSKCLPTRETVREKPQPSARFQCVLRIYTAEDELSQYSVGRGQWKLLTNTKGVAPLAN
WEVSSQDDGTTLLTASCHKEASRRLVYEWIRGAGYGKQYEVMTRPKGSSDINAQFVPVKLALLRDGVAGWPTQGYFYHFI
DGALQAECQIAGEGRWSYQLLCSDERGLDERPLFERHLSHFLLPYRIENHSPGEQYLLYRRERLSTEEWASLSSSWLAQH
GLRLNMDAVIAAFNGPLTTEVRQEDIPPSGHLRVGHVYPFGDVWGQYRHPELAPELVHIQTDSSVNQRMPVVMVGEWDGE
GYSTGEQVSMTQLTGRGPFYLKTPRAPRAKFWFSRIDQRAEFSAEKASERLSDSDQRDVLECSDGTQMTSFNKSMNAWVT
HFWDDNPLPEELDVLVLHNGYTGAAGVRIDLDELDPGQQILVTGGTLSGCTMVTGVKGRQFYALHAGTAISPNEWKTGQH
GVRDNYALLKLMMPENDLTAPPEWDNDGMPALLDCFSQATMAYSGKPEAKMQRADARCFNYYRPEILYSVCCSFSLIKKD
RHGNVSVETLTELGEISQDSSAENKSVSNFVYEARDTRVKVLL*

  Nucleotide sequence: 1812 bp    .

>EFF01524 BATJ01000011:161248-163059 [Vibrio proteolyticus NBRC 13287]
ATGCCAAATACCAAAAAAACAGCAGCCCGATTTGTCGCGGCTTATTATCCGCCGGTAGAGACACCCCAGTCTAAATGTCT
GCCAACCAGGGAGACGGTCAGAGAAAAACCTCAGCCGAGTGCTCGCTTTCAGTGCGTACTGAGAATCTATACCGCTGAGG
ATGAACTGAGTCAGTACAGTGTAGGGCGAGGTCAGTGGAAACTGCTGACGAATACAAAAGGGGTTGCGCCTTTGGCCAAC
TGGGAAGTGAGCTCACAAGACGACGGGACCACGTTACTGACCGCGTCTTGCCATAAAGAAGCCAGTCGCAGGTTAGTGTA
TGAGTGGATTCGAGGGGCGGGTTATGGCAAACAGTATGAGGTCATGACCCGCCCCAAAGGCTCGTCTGACATCAATGCAC
AGTTTGTTCCCGTTAAACTGGCTTTGCTTCGTGACGGTGTCGCAGGCTGGCCAACGCAAGGCTACTTCTATCATTTTATT
GATGGAGCGCTGCAGGCTGAATGCCAGATTGCAGGCGAAGGTCGCTGGAGCTATCAGTTGCTCTGTTCGGACGAACGCGG
GCTGGATGAGCGTCCGCTGTTCGAGCGCCATCTTTCGCATTTTTTGCTGCCCTATCGAATCGAGAACCATTCGCCGGGTG
AGCAGTATTTACTGTATCGCCGTGAACGACTTTCCACTGAAGAGTGGGCCAGCCTCTCATCTTCATGGTTGGCTCAGCAT
GGACTTCGCCTGAATATGGACGCTGTCATTGCCGCGTTCAATGGCCCGTTGACGACAGAAGTTCGACAAGAAGATATTCC
GCCAAGTGGTCACTTGCGAGTTGGCCATGTGTATCCGTTTGGAGATGTCTGGGGCCAATATCGCCATCCAGAACTGGCTC
CTGAGCTGGTGCACATTCAGACGGATTCTTCTGTGAACCAACGTATGCCTGTCGTGATGGTGGGAGAATGGGACGGAGAG
GGGTACAGCACCGGTGAGCAGGTTTCGATGACACAATTGACCGGACGAGGGCCGTTTTACCTCAAAACGCCACGCGCACC
ACGAGCGAAGTTTTGGTTTTCGCGGATTGATCAAAGGGCAGAGTTTAGCGCGGAAAAAGCCTCTGAGCGTCTCAGTGACA
GCGACCAACGGGATGTACTGGAGTGCAGTGATGGCACACAGATGACGTCGTTCAACAAATCAATGAACGCTTGGGTGACT
CATTTCTGGGATGACAATCCACTGCCCGAAGAGCTGGATGTGCTTGTGTTGCACAATGGTTATACCGGAGCGGCAGGCGT
ACGCATTGACCTGGATGAACTGGATCCGGGCCAGCAAATACTTGTGACGGGTGGAACATTGAGTGGCTGCACCATGGTCA
CGGGTGTCAAAGGGCGGCAGTTTTACGCCTTGCATGCCGGGACAGCGATCTCTCCCAATGAGTGGAAAACAGGTCAGCAC
GGAGTGCGCGACAATTATGCACTGCTTAAATTGATGATGCCTGAGAACGATCTGACGGCACCGCCTGAGTGGGATAATGA
TGGTATGCCAGCATTACTGGATTGTTTTTCTCAGGCAACCATGGCCTACAGCGGAAAGCCGGAAGCCAAAATGCAGCGTG
CGGACGCGCGTTGTTTTAATTATTATCGGCCGGAAATTCTCTACAGTGTTTGTTGCTCGTTCTCACTGATCAAAAAGGAC
CGCCACGGTAACGTCAGTGTTGAGACGTTAACCGAACTGGGCGAGATCAGTCAGGACAGTTCTGCAGAGAATAAGAGTGT
TTCTAATTTTGTTTATGAGGCGCGTGACACTCGGGTGAAAGTATTACTTTGA