Detailed information of effector


Summary

Effector ID EFF01523 experimental
Effector type Tde
Cognate immunity protein -
Related T6SS (Type) T6SS00944 experimental (Type Unknown)
Strain Escherichia coli strain PE086
Replicon chromosome
Sequence Protein sequence (117 a.a.); Nucleotide sequence (351 bp)
Description Hcp-ET4 is functional with colicin-DNase toxin domin
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) het2 (Hcp-ET4)
Coordinates (Strand) 1508..1858 (+)
NCBI ID 1062685124
GenBank KX118289
Uniprot ID A0A1C9CJM3_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-116 MSVSNNGNGAPIPAHIVDKLRGREFKTFDEFREALWLEVSQDPELIAQFSEINQLRISQGFTPFAPDEGHYIGPKETLKKFQIHHFIAIEYGGGVYDIDNLRIVTPRLHDEIHYRR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9932 - -



  Protein sequence: 117 a.a.    .

>EFF01523 KX118289:1508-1858 [Escherichia coli]
MSVSNNGNGAPIPAHIVDKLRGREFKTFDEFREALWLEVSQDPELIAQFSEINQLRISQGFTPFAPDEGHYIGPKETLKK
FQIHHFIAIEYGGGVYDIDNLRIVTPRLHDEIHYRR*

  Nucleotide sequence: 351 bp    .

>EFF01523 KX118289:1508-1858 [Escherichia coli]
ATGTCGGTATCCAATAACGGCAACGGCGCACCAATCCCGGCGCATATTGTTGATAAATTGCGCGGACGGGAGTTTAAAAC
CTTTGATGAGTTTCGCGAGGCGCTGTGGCTGGAGGTGAGTCAGGATCCGGAGTTGATAGCGCAGTTTTCGGAAATTAATC
AGTTACGTATTAGTCAGGGCTTTACACCTTTTGCCCCCGACGAAGGACACTATATTGGTCCTAAAGAAACACTTAAAAAA
TTTCAGATACATCATTTTATTGCTATTGAATATGGCGGCGGCGTATACGATATTGATAATTTACGAATTGTTACCCCCAG
ACTACACGATGAGATTCACTACAGGAGATAA