Detailed information of effector


Summary

Effector ID EFF01520 experimental
Effector type Tde
Cognate immunity protein IMU00344 experimental
Related T6SS (Type) T6SS00941 (Type Unknown)
Strain Escherichia coli strain STEC004
Replicon chromosome
Sequence Protein sequence (393 a.a.); Nucleotide sequence (1179 bp)
Description Hcp with the C-terminal ET-toxin domain, acts by degrading target cell DNA.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) AAF13_24950 (Hcp-ET1)
Coordinates (Strand) 4965377..4966555 (-)
NCBI ID 445988041
RefSeq NZ_CP011331
Uniprot ID A0A0E0XSY1_ECO1C, A0A1C9CJD7_ECOLX, B7L4W8_ECO55
KEGG ID eck:EC55989_3851, esl:O3K_01845
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 1.2e-11 26..139

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-392 MSNIVYLTVTGEQQGSISAGCGTSESTGNRWQSGHEDEIFTFSLLNNINNTGLGSQFHGITFCKLIDKSTPLFINSINNNEQLFMGFDFYRINRFGRLEKYYYIQLRGAFLSAIHHQIIENQLDTETITISYEFILCQHLIANTEFSYLALPENYNRLFLPNSKNQTNNRFKTLNSKAIGRLLAAGGVYNGNIEGFRDTAEKLGGDAIKGYDQILNEKTAGIAIATASILLTKRSNVDTYTEINSYLGKLRGQQKLLDGIDIIEIIYIKRPSKDLANLRKEFNKTVRKNFLIKLAKTSETSGRFNAEDLLRMRKGNVPLNYNVHHKLSLDDGGTNDFENLVLIENEPYHKVFTNMQSRIAKGILVGESKITPWAIPSGSIYPPMKNIMDHTK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7949 - -



  Protein sequence: 393 a.a.    .

>EFF01520 NZ_CP011331:c4966555-4965377 [Escherichia coli O104:H4 str. C227-11]
MSNIVYLTVTGEQQGSISAGCGTSESTGNRWQSGHEDEIFTFSLLNNINNTGLGSQFHGITFCKLIDKSTPLFINSINNN
EQLFMGFDFYRINRFGRLEKYYYIQLRGAFLSAIHHQIIENQLDTETITISYEFILCQHLIANTEFSYLALPENYNRLFL
PNSKNQTNNRFKTLNSKAIGRLLAAGGVYNGNIEGFRDTAEKLGGDAIKGYDQILNEKTAGIAIATASILLTKRSNVDTY
TEINSYLGKLRGQQKLLDGIDIIEIIYIKRPSKDLANLRKEFNKTVRKNFLIKLAKTSETSGRFNAEDLLRMRKGNVPLN
YNVHHKLSLDDGGTNDFENLVLIENEPYHKVFTNMQSRIAKGILVGESKITPWAIPSGSIYPPMKNIMDHTK*

  Nucleotide sequence: 1179 bp    .

>EFF01520 NZ_CP011331:c4966555-4965377 [Escherichia coli O104:H4 str. C227-11]
ATGAGTAATATTGTTTACCTGACAGTAACGGGAGAACAACAAGGAAGCATCTCCGCAGGTTGTGGGACTTCTGAGTCTAC
AGGTAATCGTTGGCAGAGCGGGCATGAGGATGAAATATTTACATTCTCACTCTTAAATAATATTAATAATACGGGGCTTG
GTTCACAGTTCCATGGTATAACATTTTGTAAATTAATTGATAAAAGCACTCCATTATTTATTAATTCCATTAACAATAAT
GAACAATTATTTATGGGATTTGACTTCTATCGAATAAATAGATTTGGTAGATTGGAAAAGTATTATTATATACAACTAAG
AGGCGCTTTTTTATCGGCTATTCATCACCAGATCATTGAAAACCAACTGGATACAGAAACAATAACTATTAGTTATGAAT
TTATCCTCTGTCAACATCTTATCGCAAATACCGAGTTCAGCTATTTGGCACTCCCTGAAAATTATAACCGTTTGTTTTTA
CCAAATTCAAAAAACCAAACAAATAATCGTTTCAAAACGTTAAACAGCAAAGCTATTGGCAGGCTACTTGCTGCTGGTGG
CGTATACAATGGGAACATTGAAGGATTCAGAGATACTGCGGAAAAACTGGGTGGAGATGCAATAAAAGGCTATGATCAAA
TACTAAATGAAAAAACAGCGGGCATAGCGATAGCAACAGCATCTATTCTTTTAACAAAGCGTTCTAATGTTGATACATAT
ACAGAAATAAATAGTTACTTAGGCAAACTTAGAGGTCAACAAAAACTTCTTGATGGTATAGACATAATAGAAATAATATA
CATTAAGAGACCTTCAAAAGACTTAGCTAACTTACGAAAGGAGTTTAATAAAACTGTAAGAAAAAATTTTCTTATCAAAC
TTGCAAAAACCTCCGAAACATCTGGAAGATTCAACGCCGAAGACCTTTTAAGAATGAGAAAGGGCAATGTTCCTCTAAAT
TATAATGTTCACCATAAACTATCTCTAGATGATGGTGGTACTAATGATTTCGAAAATTTAGTATTAATCGAAAACGAACC
ATATCATAAAGTTTTTACTAACATGCAATCACGAATAGCTAAGGGAATATTAGTAGGTGAAAGCAAAATCACTCCCTGGG
CCATTCCATCTGGCTCAATTTATCCTCCCATGAAAAATATTATGGACCACACAAAATGA