Detailed information of effector


Summary

Effector ID EFF01515 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (163 a.a.); Nucleotide sequence (489 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_1610 (Rhs2)
Coordinates (Strand) 1693944..1694432 (+)
NCBI ID 560173454
GenBank HG326223
Uniprot ID UPI0003C9C41B
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-162 MNEFDFDSLLQRIDSSCFFSRMGLPDVLDSRVILIENVEKVFVNPTDAEFKGYYDSVEWLPTSMTQEDPFYKVKEVLPKELTGLRIRVNKAVMNATKGLSKDKFNYGPHDFSLAARNGICFAFREYVSEQYLHLGNKWEEVVGIYFSGHWPVGIAKDKIVTI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9961 - -



  Protein sequence: 163 a.a.    .

>EFF01515 HG326223:1693944-1694432 [Serratia marcescens subsp. marcescens Db11]
MNEFDFDSLLQRIDSSCFFSRMGLPDVLDSRVILIENVEKVFVNPTDAEFKGYYDSVEWLPTSMTQEDPFYKVKEVLPKE
LTGLRIRVNKAVMNATKGLSKDKFNYGPHDFSLAARNGICFAFREYVSEQYLHLGNKWEEVVGIYFSGHWPVGIAKDKIV
TI*

  Nucleotide sequence: 489 bp    .

>EFF01515 HG326223:1693944-1694432 [Serratia marcescens subsp. marcescens Db11]
ATGAATGAATTTGACTTTGATAGTTTACTACAGCGCATCGATAGCTCATGCTTTTTCTCAAGAATGGGGCTCCCAGATGT
TCTGGATAGTCGCGTGATTTTAATTGAAAATGTTGAGAAGGTGTTTGTTAATCCCACTGATGCAGAGTTTAAGGGATACT
ATGATAGTGTGGAATGGTTGCCAACATCAATGACTCAGGAGGATCCTTTCTACAAAGTAAAGGAGGTATTACCTAAGGAA
CTTACTGGTTTACGTATTCGAGTAAACAAGGCTGTCATGAATGCAACAAAGGGATTGTCTAAGGATAAATTCAATTACGG
GCCTCATGACTTCAGCTTAGCAGCCAGAAATGGAATTTGTTTTGCGTTCAGAGAGTATGTTTCTGAACAGTATCTTCATT
TAGGGAATAAGTGGGAAGAAGTTGTGGGTATATACTTTTCTGGTCACTGGCCTGTGGGTATAGCAAAAGATAAGATAGTT
ACCATTTAA