Detailed information of effector


Summary

Effector ID EFF01514 experimental
Effector type Tme
Cognate immunity protein -
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (227 a.a.); Nucleotide sequence (681 bp)
Description Tfe2 intoxication leads to extensive Tfe2 intoxication leads to extensive nutrient imbalance, interference with plasma membrane transporters and induction of autophagy
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_1083 (Tfe2)
Coordinates (Strand) 1147856..1148536 (+)
NCBI ID 560172929
GenBank HG326223
Uniprot ID UPI0003C97954
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-226 MPLEVDGIIRGDRGSEPSRWQHASTKPLITLTWHHTIPWNCLRNVWNGLVAGQHWNALDEFMNLIGVPNRAEVITQIKNKNLQDRDGLHTLVTWQGWNIVEGPGNEYRAQGDDPGENFDGWSGKGMSTNQQATLQQVNVLYQVMAPLGSRALDAARQAPNISAEEASVLQRTIKQTRPTLRGKEPIRWQEDMWHQVQPGKEAKHFARWDTKPVWRKRLHSDLAQAG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9892 - -



  Protein sequence: 227 a.a.    .

>EFF01514 HG326223:1147856-1148536 [Serratia marcescens subsp. marcescens Db11]
MPLEVDGIIRGDRGSEPSRWQHASTKPLITLTWHHTIPWNCLRNVWNGLVAGQHWNALDEFMNLIGVPNRAEVITQIKNK
NLQDRDGLHTLVTWQGWNIVEGPGNEYRAQGDDPGENFDGWSGKGMSTNQQATLQQVNVLYQVMAPLGSRALDAARQAPN
ISAEEASVLQRTIKQTRPTLRGKEPIRWQEDMWHQVQPGKEAKHFARWDTKPVWRKRLHSDLAQAG*

  Nucleotide sequence: 681 bp    .

>EFF01514 HG326223:1147856-1148536 [Serratia marcescens subsp. marcescens Db11]
ATGCCATTAGAAGTCGATGGGATCATTAGAGGCGATCGGGGCAGTGAACCGAGCCGTTGGCAACATGCGTCAACCAAACC
GCTTATCACGCTGACCTGGCATCACACCATTCCTTGGAACTGTTTGCGTAATGTCTGGAATGGTCTGGTGGCGGGGCAGC
ATTGGAACGCGCTGGACGAGTTTATGAACCTGATCGGTGTGCCAAACCGTGCCGAGGTGATCACACAGATCAAGAATAAA
AACCTGCAGGATCGCGATGGATTACACACTCTGGTGACCTGGCAAGGATGGAACATCGTCGAGGGGCCTGGTAATGAGTA
TCGTGCGCAGGGGGACGATCCCGGTGAAAACTTCGACGGTTGGTCGGGTAAGGGGATGAGCACTAATCAGCAAGCGACGC
TGCAGCAGGTCAACGTGTTGTATCAGGTGATGGCGCCGCTGGGAAGCCGTGCGCTGGACGCCGCCAGACAGGCGCCGAAC
ATTTCTGCGGAAGAAGCGAGCGTCTTGCAACGGACGATTAAACAGACCCGTCCAACGTTGCGAGGAAAGGAACCGATCCG
GTGGCAAGAAGACATGTGGCATCAGGTGCAGCCGGGTAAAGAGGCGAAACACTTCGCCCGTTGGGACACCAAACCGGTGT
GGCGCAAGCGCCTGCACAGCGATCTGGCTCAGGCTGGATAA