Detailed information of effector


Summary

Effector ID EFF01513 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (643 a.a.); Nucleotide sequence (1929 bp)
Description SMA2276 (VgrG)
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_2276 (VgrG)
Coordinates (Strand) 2400742..2402670 (+)
NCBI ID 560174119
GenBank HG326223
Uniprot ID UPI0003C982D4
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 2.3e-89 25..330
Phage_base_V PF04717.14 2.5e-14 385..452

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-642 MLDRIIAHTPLGQEQLLFRSLDGIEALSTPFDFSIELLSTDARLDRKALLGQPLTLEIPTQGFLSAPRYLNGKITAIAVSSEEIGGTRYAVYNLHVQPDLWPMTKDRNFRIFQEQTVPQIVKTLLAEHNVQLEDQLTGDYRLWGYCVQYNESSFNFISRLMELEGIYYYFKHEMGKHTLVLGDAPHHHQPYPGYEMIPYHLTPSGGSTSEEGISQWTLSDRVTPGIYSLDDYDFRKPNAWLFQARQNPVSPTPGQIDVYDWPGRYTEHQQGEFYARVRQEAWQAEHQQIRGTATALGIAPGSTFTLYNAPHADDNREYLTLQANYHLKENRYASGDDQSSEHRIDFIVLPADVPWHPPQQATWPKTHGPQTARVVGPAGESIWTDKYGRIKVKFHWDRFGPKDDGSSCWVRVSSAWAGQGYGGVQIPRVNDEVVVDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFMSRTKDGTADNANALRFEDKAGAEQVWIQAERNMDTQVKNDESHTIANDHTHLVGGNQIKRVVLNQATGVKGESSALTGKTRSDAVVNAFTLGSGESLRLECGESVIELLANGQINITGTSFNITVKEDGEINTGGQLDLNQPGGAARTAAPGGGHQAAIQSAVDQLFPKS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9936 - -



  Protein sequence: 643 a.a.    .

>EFF01513 HG326223:2400742-2402670 [Serratia marcescens subsp. marcescens Db11]
MLDRIIAHTPLGQEQLLFRSLDGIEALSTPFDFSIELLSTDARLDRKALLGQPLTLEIPTQGFLSAPRYLNGKITAIAVS
SEEIGGTRYAVYNLHVQPDLWPMTKDRNFRIFQEQTVPQIVKTLLAEHNVQLEDQLTGDYRLWGYCVQYNESSFNFISRL
MELEGIYYYFKHEMGKHTLVLGDAPHHHQPYPGYEMIPYHLTPSGGSTSEEGISQWTLSDRVTPGIYSLDDYDFRKPNAW
LFQARQNPVSPTPGQIDVYDWPGRYTEHQQGEFYARVRQEAWQAEHQQIRGTATALGIAPGSTFTLYNAPHADDNREYLT
LQANYHLKENRYASGDDQSSEHRIDFIVLPADVPWHPPQQATWPKTHGPQTARVVGPAGESIWTDKYGRIKVKFHWDRFG
PKDDGSSCWVRVSSAWAGQGYGGVQIPRVNDEVVVDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFMSRTKDGTA
DNANALRFEDKAGAEQVWIQAERNMDTQVKNDESHTIANDHTHLVGGNQIKRVVLNQATGVKGESSALTGKTRSDAVVNA
FTLGSGESLRLECGESVIELLANGQINITGTSFNITVKEDGEINTGGQLDLNQPGGAARTAAPGGGHQAAIQSAVDQLFP
KS*

  Nucleotide sequence: 1929 bp    .

>EFF01513 HG326223:2400742-2402670 [Serratia marcescens subsp. marcescens Db11]
ATGTTGGACCGCATTATTGCGCACACGCCGCTGGGCCAGGAGCAACTGTTGTTCCGCTCACTGGACGGTATCGAAGCGCT
TTCCACCCCTTTTGACTTCTCTATTGAATTGCTGAGCACCGACGCGCGGCTCGATCGCAAAGCGCTGCTCGGCCAACCGC
TGACGCTGGAGATCCCAACCCAGGGCTTCCTCAGCGCCCCGCGCTACCTGAACGGCAAGATCACCGCCATCGCCGTCAGC
AGCGAAGAGATCGGCGGCACGCGCTACGCGGTGTATAACCTGCACGTGCAGCCGGATCTCTGGCCGATGACCAAGGACCG
CAACTTCCGCATCTTCCAGGAACAGACGGTGCCGCAGATCGTCAAGACCCTGCTGGCGGAGCACAACGTGCAGCTGGAAG
ATCAGCTGACCGGCGACTATCGCCTGTGGGGCTACTGCGTGCAGTACAACGAAAGCAGTTTCAACTTCATCAGCCGCCTG
ATGGAGCTGGAGGGCATCTATTACTATTTCAAACACGAGATGGGCAAACACACGCTGGTGCTCGGGGACGCCCCCCACCA
CCACCAGCCCTATCCCGGCTATGAGATGATCCCCTACCACCTGACGCCGTCCGGCGGCAGCACCAGCGAGGAAGGCATCA
GCCAGTGGACGTTGTCCGATCGCGTCACGCCGGGTATCTACAGCCTGGACGACTACGATTTCCGCAAGCCGAACGCCTGG
CTGTTCCAGGCACGGCAAAACCCGGTCTCGCCGACGCCGGGGCAGATCGACGTTTACGACTGGCCGGGCCGCTACACCGA
GCATCAGCAGGGGGAGTTCTACGCCCGCGTGCGCCAGGAGGCCTGGCAGGCCGAACATCAGCAGATCCGCGGTACCGCCA
CCGCGCTGGGCATTGCTCCCGGCAGCACCTTTACGCTGTATAACGCCCCGCACGCCGACGACAACCGCGAGTACCTGACG
CTGCAGGCCAACTACCATCTGAAAGAGAACCGCTATGCCAGCGGCGACGATCAGAGCAGCGAACACCGTATCGACTTCAT
CGTGCTGCCGGCGGACGTGCCCTGGCACCCGCCGCAGCAGGCCACCTGGCCGAAAACCCACGGGCCGCAGACCGCCCGGG
TGGTCGGCCCGGCCGGCGAATCGATTTGGACCGACAAATACGGCCGTATCAAGGTGAAGTTCCACTGGGATCGCTTCGGG
CCGAAAGACGACGGCAGCTCCTGCTGGGTGCGCGTCTCCAGCGCCTGGGCCGGCCAAGGCTACGGCGGCGTGCAGATCCC
GCGCGTGAACGACGAAGTGGTGGTGGACTTTATCAACGGCGATCCGGATCGGCCGATCGTCACCGGGCGCGTCTATAACG
AAGCCAGCATGCCGCCTTGGGCGCTGCCGGCCGCCGCCACCCAGATGGGCTTTATGAGCCGCACCAAGGACGGCACCGCC
GACAACGCCAACGCCCTGCGTTTCGAAGACAAGGCCGGCGCCGAACAGGTGTGGATCCAGGCGGAGCGCAACATGGACAC
CCAGGTGAAAAACGATGAAAGCCACACCATCGCTAACGACCACACGCATCTGGTGGGCGGCAACCAGATCAAACGGGTGG
TGCTCAATCAGGCAACCGGCGTCAAAGGCGAATCCTCCGCGCTGACCGGCAAAACGCGCAGCGACGCCGTGGTTAACGCC
TTTACCCTCGGCTCCGGCGAATCGCTGCGGCTCGAGTGCGGCGAAAGCGTGATCGAGCTGCTGGCGAACGGCCAAATCAA
CATCACCGGCACCAGCTTCAATATCACGGTGAAAGAGGACGGAGAGATCAATACCGGCGGCCAGCTGGATCTCAACCAGC
CTGGCGGCGCCGCGCGCACCGCCGCACCGGGCGGTGGCCATCAGGCGGCAATCCAGAGCGCCGTCGATCAGCTGTTCCCG
AAATCCTGA