Detailed information of effector


Summary

Effector ID EFF01512 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (787 a.a.); Nucleotide sequence (2361 bp)
Description SMA2244 (VgrG)
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_2244 (VgrG)
Coordinates (Strand) 2365103..2367463 (+)
NCBI ID 560174087
GenBank HG326223
Uniprot ID UPI0003C98210
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 4.7e-89 32..335
Phage_base_V PF04717.14 2.1e-13 390..457

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-786 MPKAGNSMDRLIIAHTPLPSHQLLFRSLSGEEKLAGLFEFDVELLSPDNRLDLKALLGQKITLELRGNPLAPRYLNGNITRMTLSGREAGGNRYYIYRAVLRPTLWYLTQNRDFRIHQEKTVPDILTQVLGQYQVKIDNRLSYDYRIWGYCVQYQESDFDFISRLMEHEGIYYYFTHQQDGHTLVLADAPAAHQELAGYASIPYQLAEGGLVENKDSINSWSVSDAITPSLYSLDDYDFRKPRARLLEARQNPASFAQDKAEVFDWPGRYTDHAHGQFYVKVRQQEFEAQHEQMSGEGNSQGIAPGYRFQLTQAPRMEDNRAYLVVSAQYFMQENSYASNDNDVGEQRTEFQVVPADINWRPARTTPWPKTHGPQTAEVVGPEGESIWTDKYGRVKLKFRWDRHGSGNETSSCWVRVSSAWAGWKYGGIQIPRVGEEVVVDFINGDPDRPIITGRVYNEDSMPPWDLPGDATKMGFMSRSKGGGADNASFLFLEDSPGNESFDMHAERNMNMTVENDKNVNIDGSRTTTIGRQQDDTVTGDATFLYKAKRTTTVNGLDTANLNAHQTVNIKGGRDLTIIDGGDKIDITGNQSFKLDGAQTQNITQTQHVTVKGNQTLDITEGQQTSTIKQGQTVNITAGGQHTTITAGGQVLTIEAGGQTATVTGDVTETYNNNQNTTITGTLTIKAKTIDITSADGVSVQTPNWKDNCHGWKWVATGANFAFYGSNLSLTATSLKHTMLDISHNPLSISKTNFKLSNDPMTFTQLGALVTNGALRLSTKALAIFL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9950 - -



  Protein sequence: 787 a.a.    .

>EFF01512 HG326223:2365103-2367463 [Serratia marcescens subsp. marcescens Db11]
MPKAGNSMDRLIIAHTPLPSHQLLFRSLSGEEKLAGLFEFDVELLSPDNRLDLKALLGQKITLELRGNPLAPRYLNGNIT
RMTLSGREAGGNRYYIYRAVLRPTLWYLTQNRDFRIHQEKTVPDILTQVLGQYQVKIDNRLSYDYRIWGYCVQYQESDFD
FISRLMEHEGIYYYFTHQQDGHTLVLADAPAAHQELAGYASIPYQLAEGGLVENKDSINSWSVSDAITPSLYSLDDYDFR
KPRARLLEARQNPASFAQDKAEVFDWPGRYTDHAHGQFYVKVRQQEFEAQHEQMSGEGNSQGIAPGYRFQLTQAPRMEDN
RAYLVVSAQYFMQENSYASNDNDVGEQRTEFQVVPADINWRPARTTPWPKTHGPQTAEVVGPEGESIWTDKYGRVKLKFR
WDRHGSGNETSSCWVRVSSAWAGWKYGGIQIPRVGEEVVVDFINGDPDRPIITGRVYNEDSMPPWDLPGDATKMGFMSRS
KGGGADNASFLFLEDSPGNESFDMHAERNMNMTVENDKNVNIDGSRTTTIGRQQDDTVTGDATFLYKAKRTTTVNGLDTA
NLNAHQTVNIKGGRDLTIIDGGDKIDITGNQSFKLDGAQTQNITQTQHVTVKGNQTLDITEGQQTSTIKQGQTVNITAGG
QHTTITAGGQVLTIEAGGQTATVTGDVTETYNNNQNTTITGTLTIKAKTIDITSADGVSVQTPNWKDNCHGWKWVATGAN
FAFYGSNLSLTATSLKHTMLDISHNPLSISKTNFKLSNDPMTFTQLGALVTNGALRLSTKALAIFL*

  Nucleotide sequence: 2361 bp    .

>EFF01512 HG326223:2365103-2367463 [Serratia marcescens subsp. marcescens Db11]
ATGCCTAAAGCGGGGAATAGTATGGATCGTCTTATCATTGCGCACACGCCCTTGCCCTCCCATCAGCTGTTGTTCAGAAG
CCTTTCCGGCGAGGAAAAACTGGCCGGATTGTTCGAGTTCGACGTCGAGTTGCTCAGCCCCGACAATCGGCTCGATCTGA
AAGCGCTGCTGGGACAAAAAATCACGCTGGAGCTGCGGGGCAATCCGTTGGCGCCGCGTTATCTCAACGGCAATATCACG
CGCATGACCCTCTCCGGCCGAGAAGCTGGCGGCAACCGTTACTATATCTACCGCGCCGTGCTGCGCCCCACGCTGTGGTA
TCTGACGCAAAACCGCGATTTTCGCATCCACCAGGAAAAAACCGTTCCCGACATCCTGACTCAGGTGCTGGGGCAGTATC
AGGTGAAAATCGATAACCGCCTGAGTTACGACTACCGCATCTGGGGATACTGCGTGCAGTATCAGGAGAGCGATTTCGAT
TTCATCAGCCGTCTGATGGAACACGAAGGCATCTATTATTATTTCACGCACCAGCAAGACGGCCATACGCTGGTGCTGGC
TGACGCGCCGGCGGCCCATCAGGAACTCGCCGGCTACGCCAGCATTCCCTACCAGCTCGCGGAAGGTGGCCTGGTGGAAA
ACAAGGACAGCATCAATAGCTGGAGCGTTTCTGACGCCATCACGCCCAGCCTCTATAGCCTGGATGACTACGATTTTCGT
AAGCCACGCGCGCGGTTGCTGGAGGCCCGGCAGAATCCCGCCTCGTTCGCGCAGGACAAAGCCGAGGTGTTCGACTGGCC
CGGTCGCTATACCGATCACGCCCACGGCCAGTTTTACGTCAAGGTTCGCCAACAGGAGTTCGAAGCGCAGCACGAGCAGA
TGAGCGGCGAAGGCAATTCGCAGGGCATTGCGCCCGGCTACCGTTTTCAACTGACCCAGGCGCCGCGTATGGAAGACAAC
CGCGCCTACCTGGTGGTCAGCGCGCAGTACTTCATGCAGGAAAACAGCTACGCCAGCAACGATAATGATGTTGGCGAGCA
GCGAACCGAATTTCAGGTCGTTCCGGCGGACATCAATTGGCGCCCGGCGCGCACCACGCCTTGGCCGAAAACCCACGGCC
CGCAAACTGCCGAAGTAGTGGGCCCGGAAGGCGAAAGCATCTGGACCGATAAATATGGCCGGGTGAAACTCAAATTCCGT
TGGGATCGCCACGGCAGCGGCAATGAAACCAGTTCCTGTTGGGTGCGCGTCTCGAGCGCCTGGGCCGGCTGGAAATACGG
TGGGATCCAGATCCCGCGCGTGGGTGAGGAAGTGGTGGTCGACTTTATCAACGGCGATCCGGATCGCCCTATCATCACCG
GCCGCGTTTACAACGAAGACAGCATGCCGCCGTGGGATCTGCCCGGCGACGCCACTAAAATGGGCTTTATGAGCCGCAGT
AAAGGCGGCGGCGCCGACAACGCCAGCTTCCTGTTCCTGGAAGACTCGCCCGGCAACGAATCGTTCGACATGCATGCCGA
ACGCAACATGAACATGACGGTGGAAAACGACAAGAACGTCAATATTGACGGCAGTCGCACCACCACCATCGGGCGCCAGC
AGGACGACACCGTCACCGGCGACGCCACGTTCCTGTACAAAGCGAAACGCACGACGACCGTCAATGGGCTGGACACCGCC
AACCTGAACGCTCACCAGACGGTGAACATCAAAGGCGGCCGCGACCTGACGATTATCGACGGCGGCGATAAAATCGACAT
CACCGGCAATCAGTCTTTCAAGCTTGACGGCGCGCAGACGCAAAACATTACGCAAACCCAGCATGTCACGGTGAAAGGCA
ACCAGACCCTCGACATTACCGAAGGGCAACAGACCAGCACCATCAAGCAGGGGCAGACCGTCAACATCACCGCCGGCGGT
CAGCACACCACCATTACTGCCGGCGGGCAAGTCCTGACGATTGAAGCGGGCGGCCAGACCGCTACCGTGACCGGGGATGT
CACCGAAACCTATAATAATAACCAGAACACGACGATCACCGGCACGCTGACCATCAAGGCGAAAACCATTGATATCACCA
GTGCGGACGGCGTCTCGGTACAAACGCCGAACTGGAAAGATAACTGCCACGGCTGGAAATGGGTGGCGACCGGGGCCAAT
TTTGCCTTCTACGGCTCCAATCTTTCGTTGACGGCGACCAGCCTTAAACACACGATGCTGGATATCTCGCATAACCCGCT
GTCGATCAGCAAAACCAATTTCAAGCTCAGTAATGATCCCATGACGTTCACTCAGCTTGGCGCGCTGGTCACCAACGGTG
CCTTACGATTGAGCACCAAGGCGCTGGCGATCTTCTTGTAA