Detailed information of effector


Summary

Effector ID EFF01510 experimental
Effector type Tae
Cognate immunity protein -
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Description SMA2264 (ssp2)The presence of Ssp2 in the periplasm, but not the cytoplasm, prevented growth of E.?coli.Ssp1 and Ssp2 are distinctive peptidoglycan dl-endopeptidases in terms of specificity, with the former being more promiscuous regarding the chemical structure that it is able to recognize and then cleave
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_2264 (ssp2)
Coordinates (Strand) 2386769..2387245 (+)
NCBI ID 560174107
GenBank HG326223
Uniprot ID UPI0003C94E6E
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tae4 PF14113.8 4.3e-24 47..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-158 MSRPSFQQAWQRFSEINVDITDVGKKIGGNVGLNIELGVNDPLQGFTNACAIRMSYTLNYSGFKVERGAWKTVSGKDKNWYIYRVRDIINFLNYKFGKPDKTIKNPTPSDFSKDKGILVFTVPGWNDASGHATLWNGTTCSDHCYFPKSNEASIWLLK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9871 - -



  Protein sequence: 159 a.a.    .

>EFF01510 HG326223:2386769-2387245 [Serratia marcescens subsp. marcescens Db11]
MSRPSFQQAWQRFSEINVDITDVGKKIGGNVGLNIELGVNDPLQGFTNACAIRMSYTLNYSGFKVERGAWKTVSGKDKNW
YIYRVRDIINFLNYKFGKPDKTIKNPTPSDFSKDKGILVFTVPGWNDASGHATLWNGTTCSDHCYFPKSNEASIWLLK*

  Nucleotide sequence: 477 bp    .

>EFF01510 HG326223:2386769-2387245 [Serratia marcescens subsp. marcescens Db11]
ATGAGTCGCCCTTCATTCCAACAAGCGTGGCAACGATTTAGCGAAATCAACGTAGATATTACTGACGTTGGCAAAAAGAT
AGGTGGAAATGTAGGTCTTAACATTGAGCTTGGCGTCAATGACCCATTGCAAGGATTCACCAATGCCTGCGCAATACGCA
TGAGTTACACGCTCAATTATTCTGGTTTTAAAGTTGAACGAGGAGCATGGAAGACCGTTTCAGGCAAAGATAAAAATTGG
TACATTTATCGCGTCAGAGATATTATTAACTTTTTGAATTATAAGTTCGGCAAACCTGATAAAACGATTAAAAACCCTAC
CCCTAGTGATTTTTCAAAAGACAAAGGGATATTGGTTTTCACTGTTCCAGGATGGAATGATGCCAGCGGACACGCAACAT
TATGGAACGGTACAACCTGCTCAGATCATTGTTACTTTCCAAAATCCAACGAGGCATCTATATGGTTACTAAAATAA