Detailed information of effector


Summary

Effector ID EFF01508 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (161 a.a.); Nucleotide sequence (483 bp)
Description SMA3456 (Hcp)
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_3456 (Hcp)
Coordinates (Strand) 3668840..3669322 (+)
NCBI ID 560175283
GenBank HG326223
Uniprot ID UPI0002DE0B28
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 1.7e-35 6..132

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-160 MAMDMFLKVEGINGESKNANHKQWIDVFSFNWGARQPGNMAVGGGGGAGKVNFRDLTVQALIDKATPALLKYCSAGKHLAKVQLSLCKAGGQEVEYTRITLEDVLVTHTDFIGVEHGSTLGIEYSFQAGKVSMEYWEQAKQGNKGASVQMGWDIKQNKES



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9842 - -



  Protein sequence: 161 a.a.    .

>EFF01508 HG326223:3668840-3669322 [Serratia marcescens subsp. marcescens Db11]
MAMDMFLKVEGINGESKNANHKQWIDVFSFNWGARQPGNMAVGGGGGAGKVNFRDLTVQALIDKATPALLKYCSAGKHLA
KVQLSLCKAGGQEVEYTRITLEDVLVTHTDFIGVEHGSTLGIEYSFQAGKVSMEYWEQAKQGNKGASVQMGWDIKQNKES
*

  Nucleotide sequence: 483 bp    .

>EFF01508 HG326223:3668840-3669322 [Serratia marcescens subsp. marcescens Db11]
ATGGCAATGGATATGTTTTTAAAAGTTGAAGGCATTAATGGTGAATCGAAAAATGCGAATCACAAGCAATGGATCGATGT
CTTTTCCTTTAACTGGGGCGCGCGACAGCCTGGCAATATGGCCGTTGGCGGCGGCGGCGGTGCGGGTAAAGTGAACTTTC
GCGATCTGACCGTACAGGCTCTGATAGATAAAGCAACACCTGCCTTATTGAAATACTGCTCGGCCGGTAAACATCTCGCC
AAGGTGCAGTTGTCTCTTTGCAAAGCCGGTGGGCAGGAAGTGGAATATACCCGCATTACCCTGGAAGATGTATTGGTGAC
TCATACCGACTTCATCGGTGTCGAGCACGGTTCCACGCTAGGCATTGAGTACTCTTTTCAGGCCGGTAAAGTGTCGATGG
AATACTGGGAGCAAGCGAAGCAAGGTAATAAAGGGGCTTCGGTGCAGATGGGCTGGGATATTAAGCAAAATAAAGAAAGC
TAA