Detailed information of effector


Summary

Effector ID EFF01506 experimental
Effector type Tme
Cognate immunity protein -
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (216 a.a.); Nucleotide sequence (648 bp)
Description SMA4673 (Ssp6)Ssp6 forms ion-selective membrane pores in vitro and Ssp6 intoxication impairs the integrity of the outer membrane.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_4673 (Ssp6)
Coordinates (Strand) 5022150..5022797 (-)
NCBI ID 560176492
GenBank HG326223
Uniprot ID UPI0003C9BF24
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-215 MAKGAKEIAQEMANAVNSKSNFFGGFIEGAISFPVDIGYLAYDFINTDNRSINRYDTERMLRLIKAGLANQHSLTKIVKLVVDEYLKKVDVDKVKRWVEKGSGKIAGRFVSNQVLMVNLGAVLSERVVIRLATGYALTSLLTLGAMNSRAIHTSRQLRQRNPEIYDNLRRAGNLDLLYFLVEPKTKPFEQAIEIWRKNRGEFDRITELFFEKVSK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9883 - -



  Protein sequence: 216 a.a.    .

>EFF01506 HG326223:c5022797-5022150 [Serratia marcescens subsp. marcescens Db11]
MAKGAKEIAQEMANAVNSKSNFFGGFIEGAISFPVDIGYLAYDFINTDNRSINRYDTERMLRLIKAGLANQHSLTKIVKL
VVDEYLKKVDVDKVKRWVEKGSGKIAGRFVSNQVLMVNLGAVLSERVVIRLATGYALTSLLTLGAMNSRAIHTSRQLRQR
NPEIYDNLRRAGNLDLLYFLVEPKTKPFEQAIEIWRKNRGEFDRITELFFEKVSK*

  Nucleotide sequence: 648 bp    .

>EFF01506 HG326223:c5022797-5022150 [Serratia marcescens subsp. marcescens Db11]
ATGGCAAAAGGTGCGAAGGAAATCGCCCAAGAGATGGCGAACGCTGTAAATTCAAAAAGTAATTTCTTTGGCGGTTTTAT
CGAAGGGGCTATCTCCTTTCCCGTCGATATAGGATACCTGGCATATGATTTTATCAATACAGATAACCGCTCTATAAATC
GATATGACACAGAAAGAATGCTTCGCCTCATTAAAGCTGGACTTGCTAACCAACACTCACTGACCAAAATCGTTAAACTT
GTCGTTGACGAATATCTGAAAAAAGTCGATGTAGATAAAGTCAAAAGATGGGTTGAAAAAGGATCCGGGAAAATTGCAGG
TAGGTTTGTGAGCAATCAGGTTCTGATGGTTAACTTAGGGGCGGTGCTTTCCGAACGGGTGGTTATTCGCCTCGCAACAG
GTTATGCCCTAACGTCACTGCTGACCCTCGGAGCTATGAACTCAAGAGCAATCCATACCTCACGCCAGTTACGACAGCGA
AACCCTGAAATTTACGATAACTTAAGGCGTGCGGGAAATTTGGATCTCTTATATTTTCTGGTAGAACCCAAAACAAAGCC
ATTTGAACAAGCGATAGAGATTTGGCGAAAAAACAGAGGCGAGTTTGACCGCATTACCGAGCTATTTTTTGAAAAGGTGT
CGAAATGA