Detailed information of effector


Summary

Effector ID EFF01505 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (276 a.a.); Nucleotide sequence (828 bp)
Description SMA4628 (Ssp5)
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_4628 (Ssp5)
Coordinates (Strand) 4979889..4980716 (+)
NCBI ID 560176449
GenBank HG326223
Uniprot ID UPI0003211E9B
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
RNAse_A_bac PF18431.3 3.6e-26 161..273

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-275 MANEDELRIALSPVQLAAVLSDESVTEGETLSNRLLGGLGLAGGVVELMGAGVLCYAPDPTFITKVGCVVVGTHSLDSIKAASNQMITGHPTTTDTYQSAVLLAQTLGADRETAYNVGLTVDIAVPFVFAGAVGAARVASVRMGRVKLVEHESVSGKYPGGHTLARHINIAPEALITRLARRPKLIAASTFRSVKEAEKYVSITVKANRADIVNWMKYASPGSRLSVYHNFKESVGYGVLRGSTDVYQCHRVGVVIEFTRYNGKPYFILSAFPAR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8166 - -



  Protein sequence: 276 a.a.    .

>EFF01505 HG326223:4979889-4980716 [Serratia marcescens subsp. marcescens Db11]
MANEDELRIALSPVQLAAVLSDESVTEGETLSNRLLGGLGLAGGVVELMGAGVLCYAPDPTFITKVGCVVVGTHSLDSIK
AASNQMITGHPTTTDTYQSAVLLAQTLGADRETAYNVGLTVDIAVPFVFAGAVGAARVASVRMGRVKLVEHESVSGKYPG
GHTLARHINIAPEALITRLARRPKLIAASTFRSVKEAEKYVSITVKANRADIVNWMKYASPGSRLSVYHNFKESVGYGVL
RGSTDVYQCHRVGVVIEFTRYNGKPYFILSAFPAR*

  Nucleotide sequence: 828 bp    .

>EFF01505 HG326223:4979889-4980716 [Serratia marcescens subsp. marcescens Db11]
ATGGCGAATGAAGATGAGTTGCGCATTGCCCTGTCGCCGGTGCAGCTTGCGGCGGTGCTGTCTGATGAAAGCGTCACTGA
AGGTGAAACGCTCAGTAACCGTCTGCTTGGCGGTTTGGGGCTTGCCGGTGGTGTCGTTGAGCTGATGGGGGCGGGGGTGT
TGTGCTATGCGCCGGATCCGACGTTTATCACCAAAGTTGGGTGTGTAGTGGTGGGAACGCATAGCCTGGACAGCATCAAA
GCCGCTTCCAATCAGATGATTACTGGGCATCCAACAACTACCGATACTTATCAGTCTGCCGTTTTATTGGCGCAAACATT
GGGTGCCGATCGGGAAACGGCCTATAACGTTGGTTTAACGGTCGATATTGCCGTGCCTTTTGTCTTTGCCGGAGCGGTTG
GCGCTGCCAGAGTCGCATCCGTGCGTATGGGGCGGGTTAAGCTGGTTGAGCATGAGTCCGTTAGCGGTAAATATCCGGGC
GGGCACACATTGGCTCGGCATATAAACATAGCTCCGGAAGCGCTTATTACCAGGCTAGCCAGGCGCCCGAAACTGATCGC
AGCAAGCACCTTCAGATCGGTAAAGGAGGCCGAAAAGTATGTTTCTATCACGGTAAAGGCGAACCGCGCAGATATTGTGA
ATTGGATGAAGTACGCGTCTCCCGGCAGCCGTTTGAGCGTGTATCATAATTTCAAAGAATCAGTGGGTTATGGGGTATTG
CGCGGCAGTACTGACGTCTATCAATGTCACCGGGTTGGCGTTGTGATTGAATTTACCCGCTATAATGGCAAACCTTACTT
TATCCTTAGCGCTTTCCCTGCGAGATAA