Detailed information of effector


Summary

Effector ID EFF01504 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (332 a.a.); Nucleotide sequence (996 bp)
Description SMA3980 (Ssp4)
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_3980 (Ssp4)
Coordinates (Strand) 4242848..4243843 (-)
NCBI ID 560175802
GenBank HG326223
Uniprot ID UPI0003247CE3
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-331 MKTAFSTPFGSPEDDLTNAEFARLLGNTGVQEFYRDINLQALQDSLDCSLAFHGVGIIFSDGQNSFLVRPTQHTGYSNASQVTHVVISKTVAHTSRVAATNTLSEALSKPSVSKELASAALSCGTLLVSVFLLASGSVAVPFTGGTSSAVAYLGYAGMAASALQCGNGLYRVNKLYDGKGDELAQLDSEQWYIATSTVLDVISLASAGAALKEATMTYRAMRRISARKATEWLKSMPRSERKRLTENIIRAENPGISNNVLKEMVKNGLYPKRYPTEAIQNGLRQQLHSALNNALTFVGSGISGTLSAPVNVKTTGQYFVGIMQKLPQMVR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9861 - -



  Protein sequence: 332 a.a.    .

>EFF01504 HG326223:c4243843-4242848 [Serratia marcescens subsp. marcescens Db11]
MKTAFSTPFGSPEDDLTNAEFARLLGNTGVQEFYRDINLQALQDSLDCSLAFHGVGIIFSDGQNSFLVRPTQHTGYSNAS
QVTHVVISKTVAHTSRVAATNTLSEALSKPSVSKELASAALSCGTLLVSVFLLASGSVAVPFTGGTSSAVAYLGYAGMAA
SALQCGNGLYRVNKLYDGKGDELAQLDSEQWYIATSTVLDVISLASAGAALKEATMTYRAMRRISARKATEWLKSMPRSE
RKRLTENIIRAENPGISNNVLKEMVKNGLYPKRYPTEAIQNGLRQQLHSALNNALTFVGSGISGTLSAPVNVKTTGQYFV
GIMQKLPQMVR*

  Nucleotide sequence: 996 bp    .

>EFF01504 HG326223:c4243843-4242848 [Serratia marcescens subsp. marcescens Db11]
ATGAAAACTGCTTTTTCTACGCCGTTCGGTTCTCCCGAAGACGATTTGACCAACGCCGAGTTTGCCCGCCTGTTGGGCAA
TACCGGCGTACAAGAATTCTATCGCGATATTAATCTGCAAGCCTTGCAGGACTCGCTGGACTGCAGCCTCGCCTTTCATG
GCGTGGGAATTATTTTTTCCGACGGGCAAAACTCATTTTTAGTCCGCCCGACGCAGCACACCGGTTACTCGAACGCTTCG
CAGGTTACCCACGTGGTCATCAGCAAAACGGTGGCTCATACCTCGCGCGTTGCCGCGACCAATACGCTGTCGGAAGCGTT
GAGCAAACCCAGCGTCAGCAAAGAGCTGGCCTCGGCCGCGCTGTCGTGTGGAACGCTGCTGGTATCGGTCTTTTTACTGG
CGTCGGGCAGCGTCGCCGTGCCATTTACCGGCGGTACCAGCTCAGCGGTGGCTTATCTGGGCTATGCCGGCATGGCCGCC
AGCGCGTTGCAGTGCGGTAATGGGCTGTACCGCGTCAACAAGCTTTATGACGGGAAAGGCGATGAATTGGCTCAGCTCGA
TTCAGAGCAGTGGTATATCGCCACCAGTACCGTGCTCGATGTGATCTCGCTGGCCAGCGCCGGGGCTGCCCTGAAGGAAG
CGACGATGACCTATCGTGCCATGCGCCGCATTTCGGCGCGCAAGGCGACGGAGTGGCTGAAAAGCATGCCCCGCAGCGAA
AGGAAGCGACTGACCGAAAACATCATTCGGGCGGAAAATCCGGGAATTTCCAACAACGTTTTGAAAGAGATGGTGAAGAA
CGGCCTGTACCCGAAACGCTACCCGACGGAAGCGATCCAAAACGGGCTGCGCCAGCAATTGCACTCGGCGCTCAATAACG
CGTTGACGTTTGTCGGCAGCGGCATCAGCGGCACCCTGTCGGCGCCGGTGAATGTGAAAACCACCGGGCAGTATTTTGTG
GGCATTATGCAGAAATTGCCGCAGATGGTGAGGTAA