Detailed information of effector


Summary

Effector ID EFF01503 experimental
Effector type Tme
Cognate immunity protein -
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (184 a.a.); Nucleotide sequence (552 bp)
Description SMA1112 (Ssp3/Tfe1)acts via a plasma membrane depolarizing mechanism that does not involve formation of large, unselective pores
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_1112 (Ssp3)
Coordinates (Strand) 1178412..1178963 (+)
NCBI ID 560172958
GenBank HG326223
Uniprot ID UPI0003C9EABA
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-183 MHWLNFKRYKSDVAKQAVPPHLNAAEFARHYADKPQTDTEEYLSLSGEMCWDAVVLCAHRSGALSKAKYKQLWQTVFDKQYKHFVSPDDTEIRTMADMLRAPQGCFIGIFSLRDAAAPRLLHAMIGTGAGFAAGNKNLCIGVGGAVGWENLNLARDLRWQPEGGFLRQGDNEVLRIFYRPFPA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9777 - -



  Protein sequence: 184 a.a.    .

>EFF01503 HG326223:1178412-1178963 [Serratia marcescens subsp. marcescens Db11]
MHWLNFKRYKSDVAKQAVPPHLNAAEFARHYADKPQTDTEEYLSLSGEMCWDAVVLCAHRSGALSKAKYKQLWQTVFDKQ
YKHFVSPDDTEIRTMADMLRAPQGCFIGIFSLRDAAAPRLLHAMIGTGAGFAAGNKNLCIGVGGAVGWENLNLARDLRWQ
PEGGFLRQGDNEVLRIFYRPFPA*

  Nucleotide sequence: 552 bp    .

>EFF01503 HG326223:1178412-1178963 [Serratia marcescens subsp. marcescens Db11]
ATGCATTGGTTGAATTTCAAGCGCTACAAGAGTGACGTTGCCAAACAGGCCGTGCCGCCGCATTTGAATGCGGCCGAATT
TGCACGGCATTACGCCGATAAGCCGCAAACCGATACGGAAGAGTATCTTTCGCTCAGCGGGGAGATGTGCTGGGATGCGG
TGGTGCTTTGTGCCCACCGTTCTGGCGCGCTCAGCAAGGCGAAATACAAGCAGTTGTGGCAGACGGTGTTCGATAAGCAA
TACAAACATTTCGTTAGCCCGGATGATACCGAGATCCGCACTATGGCCGATATGCTGCGCGCGCCGCAGGGATGTTTTAT
CGGCATATTCTCCCTGCGCGACGCGGCTGCGCCCCGTTTGCTGCATGCCATGATCGGTACCGGTGCGGGATTTGCCGCAG
GCAATAAAAATCTTTGCATCGGCGTGGGGGGCGCGGTCGGCTGGGAAAATCTCAATCTGGCGCGCGATCTGCGCTGGCAG
CCGGAAGGCGGTTTTTTACGCCAGGGTGATAACGAAGTGCTGCGCATTTTTTATCGGCCTTTCCCCGCCTGA