Detailed information of effector


Summary

Effector ID EFF01502 experimental
Effector type Tae
Cognate immunity protein -
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (164 a.a.); Nucleotide sequence (492 bp)
Description SMA2261 (Ssp1)Periplasmic Ssp1 was toxic and its effect alleviated by co-production of Rap1ab. However Ssp1 toxicity was only observed at higher expression levels and on minimal media.Ssp1 and Ssp2 are distinctive peptidoglycan dl-endopeptidases in terms of specificity, with the former being more promiscuous regarding the chemical structure that it is able to recognize and then cleave
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_2261 (Ssp1)
Coordinates (Strand) 2385090..2385581 (+)
NCBI ID 560174104
GenBank HG326223
Uniprot ID UPI000325B5E7
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tae4 PF14113.8 1.3e-16 46..160

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-163 MKPLYRQLKSSHYSSDYSSPGYLAAEAVYAEIGYELDTLLKQNPGYANTCAVRMSLALLKTGISFKGRLPIKKGAYKGKTIEPGAKLLADQLHRSSSFGKAKIFFNAPDAEKGIGNKKGVVFFNKITNYDGGHIDLIEPENSLLTCHSHCYFNCKEVWFWELS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9766 - -



  Protein sequence: 164 a.a.    .

>EFF01502 HG326223:2385090-2385581 [Serratia marcescens subsp. marcescens Db11]
MKPLYRQLKSSHYSSDYSSPGYLAAEAVYAEIGYELDTLLKQNPGYANTCAVRMSLALLKTGISFKGRLPIKKGAYKGKT
IEPGAKLLADQLHRSSSFGKAKIFFNAPDAEKGIGNKKGVVFFNKITNYDGGHIDLIEPENSLLTCHSHCYFNCKEVWFW
ELS*

  Nucleotide sequence: 492 bp    .

>EFF01502 HG326223:2385090-2385581 [Serratia marcescens subsp. marcescens Db11]
ATGAAACCTTTATATCGTCAGCTAAAAAGCAGCCATTACTCCTCTGATTACTCTAGCCCGGGATATTTGGCAGCAGAAGC
CGTTTACGCTGAGATTGGCTATGAGCTTGATACGCTTCTAAAGCAAAATCCTGGTTATGCCAATACCTGTGCCGTCCGCA
TGAGCCTGGCGCTGTTGAAAACCGGTATCAGCTTCAAAGGCCGCCTGCCAATCAAGAAAGGCGCCTATAAGGGTAAAACG
ATTGAACCGGGAGCCAAATTGCTGGCCGATCAGTTGCATCGCTCCAGTAGTTTTGGCAAAGCCAAAATTTTCTTTAATGC
TCCAGATGCAGAGAAAGGTATTGGCAATAAAAAAGGAGTCGTGTTCTTCAATAAGATCACCAACTATGATGGCGGACACA
TTGATCTTATCGAACCAGAAAACTCGCTATTAACCTGCCATTCCCATTGCTATTTTAACTGCAAAGAGGTCTGGTTTTGG
GAGTTGAGCTAG