Detailed information of effector


Summary

Effector ID EFF01494 experimental
Effector type Tle
Cognate immunity protein -
Related T6SS (Type) T6SS00158 experimental (Type ii)
Strain Francisella tularensis subsp. novicida U112
Replicon chromosome
Sequence Protein sequence (1326 a.a.); Nucleotide sequence (3978 bp)
Description pdpC
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) FTN_1319 (pdpC)
Coordinates (Strand) 1391204..1395181 (+)
NCBI ID 118497899
RefSeq NC_008601
Uniprot ID UPI0000E89600
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1325 MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHLLQFDEDYLAYMRSLRAIHPSKIAMQKIKSIRNKEDSFIIAIFSLDKIIHKTKFISFGHKTVIFDFKKLWGLVDFVIVHTSNKTWVNHKLTSFMPSITYCNQNIIHLAYHSDFLYIYHTPEFMDDINVDRENRRELVAKIPDPYWVRADTKENKININSEEENIEKDLKKITKLKNFEISANDIFFSKAIKAAPRLQHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNEGLLENLMTFLDALVVRHLYLIAVYSVYEIEIGIKSVKPEYSKLLKAGLLNKDIQNQLIYDQKKISNIIWLGETFHGLDIEEAEDLCELIDQGDINPKINPINPEKLYRAYKENYGNEALSFREYKEKYNFLDNDKLREEHANKLSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGSNPLTYYNCMLETGKRRTSKEAYFADIRNKLFMVCYLPGFLSSVIADDDFIDWYSNKKENQELLKNSYLNNLYKSKQKYIKDFIDLDIIKLLKQTSSQIKPSYIPVAFRYGAFASTTALIRSNANVSNRMEFELYDSPERLHNQYSEKEEMIMPKSVNNPKDHSIDNGISLFSLNLTNEKEDGLRKVMLKVAQLYNLDFKVGISGNLDQAMTQALILGMATTKKNGDILLDEDQMLYMTYLYCIFMAHSVDHTVDEILMSANTYLLNSEEVKYPIFNIADFFARPVFGLSKDKEFKSLVEKYENSLKPNSKILKENYISRVVTLSEVYEDIYNLNCLYSSLSEGSLYNLLSTHSERHCTLLEQYSRKKKAEIGLVQDGEKIKVVNNYSGYAAINQYQRFVSLGRMYDSGAKYSSSHKKQIEKDFNLYLPDKEQINYLKYNFKDNKFDAVYKNKKSKEKNQSHIVYAKKQNTRYCYGYFNDFFVKNRITTFYKIKDKSGNYLVNLHNEKYSFATPNSDSKIYRVSPELLNNRDDFKRVSKDIIKSYKYISFDKQKEDIVKNFGKNLYHTNYEIWVGLSHQAISCFSVLDNIDTQEAANTFIDALYYVRLMQLYYGKTIPFLWISSEIVRYSSSETHYYIPTEENFENILKIALNNASKPVIERFLIILNIYNSTIDNNALILIRCRLPIILFEYEEQKLKLKALQKCADSYKKNNYKNEINFSAWFESIFHVQNLSLSPNYIGNNILILSLVEELKPKCSEYKKNMINQQITAKANELNFYQLLIRLIEISTYHRILTKSIITNTTSLLYDILNKPEFQTINKLINKLFIYKNKDLNTDKYKAFHTKLITIESTYKKINSLYKSDFFKKISS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9972 - -



  Protein sequence: 1326 a.a.    .

>EFF01494 NC_008601:1391204-1395181 [Francisella tularensis subsp. novicida U112]
MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHLLQFDEDYLAYMRSLRAIHPSKIAMQKIKSIRNKED
SFIIAIFSLDKIIHKTKFISFGHKTVIFDFKKLWGLVDFVIVHTSNKTWVNHKLTSFMPSITYCNQNIIHLAYHSDFLYI
YHTPEFMDDINVDRENRRELVAKIPDPYWVRADTKENKININSEEENIEKDLKKITKLKNFEISANDIFFSKAIKAAPRL
QHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNEGLLENLMTFLDALVVRHLYLIAVYSVYEIEIGIKSVKPEYSKL
LKAGLLNKDIQNQLIYDQKKISNIIWLGETFHGLDIEEAEDLCELIDQGDINPKINPINPEKLYRAYKENYGNEALSFRE
YKEKYNFLDNDKLREEHANKLSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGSNPLTYYNCMLETGKRRTSKEAYFAD
IRNKLFMVCYLPGFLSSVIADDDFIDWYSNKKENQELLKNSYLNNLYKSKQKYIKDFIDLDIIKLLKQTSSQIKPSYIPV
AFRYGAFASTTALIRSNANVSNRMEFELYDSPERLHNQYSEKEEMIMPKSVNNPKDHSIDNGISLFSLNLTNEKEDGLRK
VMLKVAQLYNLDFKVGISGNLDQAMTQALILGMATTKKNGDILLDEDQMLYMTYLYCIFMAHSVDHTVDEILMSANTYLL
NSEEVKYPIFNIADFFARPVFGLSKDKEFKSLVEKYENSLKPNSKILKENYISRVVTLSEVYEDIYNLNCLYSSLSEGSL
YNLLSTHSERHCTLLEQYSRKKKAEIGLVQDGEKIKVVNNYSGYAAINQYQRFVSLGRMYDSGAKYSSSHKKQIEKDFNL
YLPDKEQINYLKYNFKDNKFDAVYKNKKSKEKNQSHIVYAKKQNTRYCYGYFNDFFVKNRITTFYKIKDKSGNYLVNLHN
EKYSFATPNSDSKIYRVSPELLNNRDDFKRVSKDIIKSYKYISFDKQKEDIVKNFGKNLYHTNYEIWVGLSHQAISCFSV
LDNIDTQEAANTFIDALYYVRLMQLYYGKTIPFLWISSEIVRYSSSETHYYIPTEENFENILKIALNNASKPVIERFLII
LNIYNSTIDNNALILIRCRLPIILFEYEEQKLKLKALQKCADSYKKNNYKNEINFSAWFESIFHVQNLSLSPNYIGNNIL
ILSLVEELKPKCSEYKKNMINQQITAKANELNFYQLLIRLIEISTYHRILTKSIITNTTSLLYDILNKPEFQTINKLINK
LFIYKNKDLNTDKYKAFHTKLITIESTYKKINSLYKSDFFKKISS*

  Nucleotide sequence: 3978 bp    .

>EFF01494 NC_008601:1391204-1395181 [Francisella tularensis subsp. novicida U112]
ATGAACGACAAATATGAACTAAATATCTATTTTGAGAAAATAGAGTTACCTAAAACAGCAGATTTCAATATGATAAGCAA
GCATGATATTAAAGAACTCAGAGTAGATGCTAATTTAAAAAAGAAAATACACTTATTACAATTTGATGAAGATTATTTAG
CATATATGAGGAGCTTAAGAGCTATTCATCCCTCAAAAATAGCAATGCAAAAAATTAAATCAATTCGCAATAAAGAAGAT
TCTTTTATAATAGCCATTTTTTCTTTAGATAAAATAATTCACAAAACTAAATTTATCTCTTTTGGACATAAAACCGTTAT
TTTTGATTTTAAAAAACTATGGGGATTAGTTGATTTCGTAATAGTTCATACAAGTAATAAAACCTGGGTTAATCATAAGT
TAACATCATTTATGCCATCAATTACATACTGTAATCAAAACATCATCCATTTAGCATACCATTCTGATTTTTTATATATT
TATCATACTCCAGAATTTATGGATGATATAAATGTAGATCGAGAAAATAGAAGAGAGTTAGTGGCAAAAATTCCCGATCC
ATATTGGGTAAGAGCTGATACTAAAGAAAATAAAATCAATATTAATTCTGAAGAGGAAAATATAGAAAAAGATTTAAAAA
AAATAACTAAATTAAAAAATTTTGAAATAAGCGCAAATGATATTTTTTTCTCAAAAGCTATAAAAGCAGCTCCAAGATTA
CAACATAAAAATAAGAGTAAATTATTTAATTCATTAGCGATTGAAAATAATGAAAAAATCAAACGTGACATAATTGATTA
TGCAATATCTAATGCTTGGTATAAAAACGAGGGGTTACTTGAAAATCTAATGACATTTTTAGACGCGCTAGTCGTAAGAC
ATCTCTACTTAATAGCAGTTTACTCAGTTTATGAAATAGAAATAGGTATTAAATCAGTAAAACCTGAGTATAGCAAATTA
TTAAAAGCTGGCCTATTGAACAAAGATATTCAAAATCAATTGATATATGATCAAAAGAAAATTAGCAATATTATTTGGCT
TGGTGAAACATTTCATGGTTTAGATATTGAAGAAGCAGAAGATTTATGTGAACTTATTGACCAAGGCGATATTAATCCAA
AAATTAATCCTATAAATCCTGAAAAGCTATATAGAGCCTATAAAGAAAATTATGGAAATGAAGCGTTAAGCTTTAGAGAA
TACAAAGAAAAATATAATTTTTTAGATAATGATAAGCTTAGAGAAGAACATGCAAATAAACTTTCAAGCATATTAGAAGA
TCCAAAATTTAGAGTTCTTAGCTATATAAATGCATTTTTATGTTCAACTAAAAATTATCTAGTACCTTATGGGTATTTAG
GAAGTAATCCTCTTACATACTATAATTGTATGCTAGAAACCGGAAAACGTAGAACATCAAAAGAAGCATATTTTGCTGAT
ATAAGAAACAAATTGTTTATGGTATGCTATCTTCCTGGCTTCTTGAGCTCTGTAATTGCTGATGATGACTTTATAGACTG
GTATTCTAATAAGAAAGAAAATCAAGAATTACTCAAAAACTCTTATTTGAACAATTTATATAAGTCAAAGCAGAAATATA
TAAAAGATTTTATAGATCTTGATATTATTAAACTTCTAAAACAGACATCATCTCAAATCAAGCCAAGCTATATACCAGTA
GCTTTTAGATATGGTGCATTTGCCTCAACAACTGCTTTGATAAGATCAAATGCAAATGTTTCTAATCGAATGGAGTTTGA
ATTATATGACTCACCTGAAAGACTACATAATCAATACTCAGAAAAAGAGGAAATGATTATGCCAAAATCGGTTAATAACC
CCAAGGATCACTCAATTGACAATGGAATATCTTTATTTAGCCTTAATCTAACAAATGAAAAAGAAGATGGACTTCGAAAA
GTTATGTTGAAAGTTGCACAACTATATAATCTTGATTTCAAGGTAGGTATCTCAGGAAATTTAGATCAAGCAATGACTCA
GGCATTAATACTTGGGATGGCAACTACAAAAAAAAATGGCGATATCTTACTTGATGAAGATCAAATGCTATATATGACAT
ACTTATACTGCATTTTCATGGCACATAGTGTCGATCATACTGTAGATGAAATACTAATGTCTGCAAATACTTATCTGTTA
AATTCTGAAGAGGTAAAGTATCCTATATTTAATATAGCTGATTTTTTTGCTAGGCCTGTATTTGGACTCTCTAAGGATAA
AGAGTTTAAATCATTAGTTGAAAAGTATGAAAATAGCCTAAAACCTAATTCAAAAATTCTCAAAGAGAATTATATAAGTA
GAGTAGTCACACTATCTGAAGTATATGAAGATATATATAACTTAAATTGTTTATATAGTTCTCTCTCAGAAGGATCCTTG
TATAATCTACTATCAACTCACAGTGAAAGACACTGTACTTTATTAGAGCAGTATTCTCGCAAGAAGAAAGCTGAGATAGG
ATTAGTCCAAGATGGAGAGAAAATAAAAGTCGTAAACAACTACAGTGGCTATGCTGCGATTAATCAATATCAACGTTTTG
TATCACTAGGCAGAATGTATGATAGTGGTGCAAAATACTCCTCTTCTCATAAAAAACAGATAGAAAAAGATTTCAACTTA
TACTTACCAGATAAAGAACAGATAAATTATCTAAAATATAACTTTAAAGATAATAAATTTGATGCTGTTTATAAAAACAA
AAAGAGCAAAGAAAAAAATCAAAGCCATATTGTGTATGCAAAAAAACAAAATACGCGATATTGCTACGGATATTTTAACG
ATTTTTTCGTTAAAAATAGAATTACGACTTTTTATAAAATAAAAGATAAATCAGGAAACTATTTAGTAAACTTACATAAT
GAAAAATATAGTTTCGCAACACCTAATTCAGATTCTAAAATATATAGAGTTTCACCAGAATTACTTAACAATAGAGATGA
TTTTAAAAGAGTATCTAAAGATATTATAAAATCATATAAATATATTAGTTTTGATAAACAAAAGGAAGATATAGTTAAAA
ATTTTGGTAAAAACTTATATCATACTAATTATGAGATATGGGTTGGGCTATCACATCAAGCTATATCATGTTTTTCAGTT
TTAGATAACATAGATACACAAGAAGCTGCTAATACTTTTATCGATGCTTTATATTATGTTAGATTAATGCAATTATATTA
TGGCAAAACTATACCTTTTTTGTGGATTAGTAGCGAAATTGTAAGATATTCTTCATCAGAAACTCACTACTATATACCAA
CAGAAGAAAACTTTGAAAATATACTTAAAATTGCTCTTAATAATGCCTCAAAACCAGTAATAGAAAGATTCTTAATTATT
CTTAACATATATAATAGTACTATTGATAATAATGCTTTAATTTTGATACGATGCCGTTTACCAATAATATTATTTGAATA
TGAAGAGCAGAAACTTAAATTAAAAGCTTTGCAAAAGTGTGCTGATTCTTATAAAAAAAATAATTATAAAAATGAAATTA
ACTTTAGTGCTTGGTTTGAATCTATATTTCATGTTCAAAACTTATCCTTATCTCCTAATTATATTGGCAATAATATTTTA
ATCTTGAGTTTAGTTGAAGAATTAAAACCAAAATGTAGTGAATATAAAAAAAACATGATTAACCAACAAATTACAGCTAA
AGCAAACGAGTTAAACTTTTATCAACTTCTAATAAGACTTATTGAAATATCAACCTATCATAGAATACTTACGAAATCAA
TCATAACTAATACAACCTCGTTACTTTATGACATATTAAATAAACCAGAATTTCAAACAATAAATAAATTAATAAATAAG
CTATTTATTTATAAAAACAAGGATCTAAATACTGATAAATATAAAGCCTTTCACACTAAGCTTATAACTATTGAAAGTAC
CTATAAAAAAATAAATAGCCTATATAAATCAGACTTTTTTAAAAAAATATCGTCATAG