Detailed information of effector


Summary

Effector ID EFF01488 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00158 experimental (Type ii)
Strain Francisella tularensis subsp. novicida U112
Replicon chromosome
Sequence Protein sequence (821 a.a.); Nucleotide sequence (2463 bp)
Description pdpA,connecting VgrG to the tube,
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) FTN_1309 (pdpA)
Coordinates (Strand) 1378294..1380756 (+)
NCBI ID 118497889
RefSeq NC_008601
Uniprot ID UPI00001A955C
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-820 MIAVKDITDLNIQDIISQLTSEVINGDTTPSSAKFACEINSYIINYNLSNINLINTQLKNTKILYRKGLISKLDYEKYKRYCIISRFKNNIDEFILYFSTNYKDSQSLKIAIKELQNSCSSSLILELPHDYIRKIDVLLTSIDSAIQRSSDLNKTIIKQLNKLRSSLSRYIGYNNVLQKQEITINIKPINKNFELEDISFVSTRNKQYFKHNSLTLKNPHIEKLEVCENIYGINGWLTFDLAYINNHKDFNFLLSPNQPILLDIQINDSFNFYKKESKKDHHKRTTRFIAIGFNSNSIDIHENFEYSIYSYTKNVSSGVKKFKIQFHDPLKALWTKHKPSYIALNKSLDDIFKDNFFFDSLFSLDTNKSNNLKIRIPQAFISTVNRNFYDFFIQQLEQNKCYLKYFCDKKSGKVSYHVVDQVDNDLQRNIVNSDEDLKDKLSPYDISCFKKQILISNKSNFYVKEKNICPDVTLNTQRKEDRKISDTLVKPFSSILKDNLQSVEYIQSNNDDKQEIITTGFEILLTSRNTLPFLDTEITLSKLDNDQNYLLGATDIKSLYISQRKLLFKRSKYCSKQLYENLHNFHYKSDSESDVYEKIAFTKYPSLTHDNSITYKIKDYSNLTPEYPKYKSFSNFYINGRITIGENVNNDSKKAYKFFKNHKPEESSIAEFQENGEKGTSAILNSKADILYAIEIAKEMLSDKSSDKPIIYLPLKVNINSANNQFIPLRNDDIILIEIQSFTKGEIIELISNSAISTKKAQQQLLQRQLLGSKENCEMAYTQTSDSETFSLTQVNEDCENSFLINDKKGIFLRYKSKGN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9622 - -



  Protein sequence: 821 a.a.    .

>EFF01488 NC_008601:1378294-1380756 [Francisella tularensis subsp. novicida U112]
MIAVKDITDLNIQDIISQLTSEVINGDTTPSSAKFACEINSYIINYNLSNINLINTQLKNTKILYRKGLISKLDYEKYKR
YCIISRFKNNIDEFILYFSTNYKDSQSLKIAIKELQNSCSSSLILELPHDYIRKIDVLLTSIDSAIQRSSDLNKTIIKQL
NKLRSSLSRYIGYNNVLQKQEITINIKPINKNFELEDISFVSTRNKQYFKHNSLTLKNPHIEKLEVCENIYGINGWLTFD
LAYINNHKDFNFLLSPNQPILLDIQINDSFNFYKKESKKDHHKRTTRFIAIGFNSNSIDIHENFEYSIYSYTKNVSSGVK
KFKIQFHDPLKALWTKHKPSYIALNKSLDDIFKDNFFFDSLFSLDTNKSNNLKIRIPQAFISTVNRNFYDFFIQQLEQNK
CYLKYFCDKKSGKVSYHVVDQVDNDLQRNIVNSDEDLKDKLSPYDISCFKKQILISNKSNFYVKEKNICPDVTLNTQRKE
DRKISDTLVKPFSSILKDNLQSVEYIQSNNDDKQEIITTGFEILLTSRNTLPFLDTEITLSKLDNDQNYLLGATDIKSLY
ISQRKLLFKRSKYCSKQLYENLHNFHYKSDSESDVYEKIAFTKYPSLTHDNSITYKIKDYSNLTPEYPKYKSFSNFYING
RITIGENVNNDSKKAYKFFKNHKPEESSIAEFQENGEKGTSAILNSKADILYAIEIAKEMLSDKSSDKPIIYLPLKVNIN
SANNQFIPLRNDDIILIEIQSFTKGEIIELISNSAISTKKAQQQLLQRQLLGSKENCEMAYTQTSDSETFSLTQVNEDCE
NSFLINDKKGIFLRYKSKGN*

  Nucleotide sequence: 2463 bp    .

>EFF01488 NC_008601:1378294-1380756 [Francisella tularensis subsp. novicida U112]
ATGATAGCAGTAAAAGATATAACTGATCTAAATATACAAGACATAATTAGTCAGTTAACTTCTGAAGTTATAAATGGCGA
CACAACCCCTTCTTCCGCCAAGTTTGCTTGTGAAATTAATAGCTATATTATTAATTACAACCTATCAAACATTAATCTTA
TTAATACTCAACTAAAAAATACAAAGATACTTTATAGAAAAGGCTTGATATCTAAGCTTGATTACGAAAAATATAAAAGA
TATTGCATAATATCTAGATTTAAAAATAACATAGATGAATTTATCTTATATTTTTCGACAAACTATAAAGACTCTCAAAG
CTTAAAAATCGCAATTAAAGAATTACAAAACTCATGCTCATCAAGTTTAATTCTTGAGCTCCCTCATGATTACATAAGAA
AAATTGATGTCTTACTAACTAGTATAGATAGTGCAATACAAAGATCAAGCGATCTCAACAAAACAATTATAAAACAGTTA
AATAAGCTTAGAAGCAGCCTTTCACGATATATTGGGTATAATAATGTACTGCAAAAACAAGAAATTACTATAAATATAAA
GCCTATTAATAAAAATTTTGAACTTGAGGATATAAGTTTTGTATCAACTAGAAATAAGCAATATTTTAAGCATAACTCTC
TTACACTTAAAAACCCTCATATTGAAAAATTAGAAGTATGTGAAAATATCTACGGCATAAACGGCTGGTTAACTTTTGAT
TTAGCATATATCAATAATCACAAAGACTTTAACTTTCTATTAAGCCCAAATCAACCCATATTGCTTGATATTCAAATTAA
TGATAGCTTCAACTTTTACAAAAAAGAATCTAAAAAAGATCATCATAAGAGAACAACCCGTTTTATAGCCATTGGCTTTA
ATTCAAACAGTATAGATATTCATGAGAACTTTGAATATAGCATATATTCTTATACCAAAAATGTTTCTTCAGGAGTAAAA
AAATTTAAAATACAATTCCATGACCCACTAAAAGCACTTTGGACTAAGCACAAACCATCCTATATAGCCTTGAACAAAAG
CTTAGATGATATCTTTAAAGATAATTTTTTCTTTGATAGTTTATTTTCTTTAGATACCAACAAAAGTAATAATCTAAAAA
TACGTATACCACAAGCATTTATTTCTACAGTTAATCGAAATTTTTATGATTTCTTTATTCAACAACTTGAGCAAAATAAA
TGCTATTTAAAATATTTCTGTGATAAGAAGAGTGGCAAAGTAAGCTATCATGTTGTAGATCAAGTAGATAATGACTTACA
AAGGAATATCGTAAATTCAGATGAAGATTTAAAAGACAAACTATCTCCTTATGATATAAGCTGCTTCAAAAAACAAATTC
TAATCTCAAATAAGTCAAACTTTTATGTTAAGGAAAAAAATATATGTCCTGATGTGACTTTAAACACTCAAAGAAAGGAA
GACCGAAAGATTTCAGATACCTTAGTAAAGCCATTCTCATCCATACTCAAGGATAACTTACAATCTGTAGAGTATATACA
AAGTAATAATGATGATAAACAAGAAATTATTACTACAGGATTTGAGATATTACTGACATCAAGAAATACTCTGCCCTTCT
TAGATACTGAAATTACTCTTTCTAAACTAGACAATGATCAAAACTATCTTTTAGGCGCAACAGATATAAAAAGCTTATAT
ATAAGTCAAAGAAAGCTATTATTTAAAAGAAGTAAATACTGCTCTAAACAACTATATGAAAACTTACATAATTTTCACTA
TAAAAGTGATTCTGAATCAGACGTATATGAAAAAATTGCTTTTACTAAATACCCTAGTCTGACACATGACAACTCAATAA
CTTATAAAATTAAGGATTATAGTAATCTAACTCCTGAATATCCTAAGTACAAAAGTTTTAGTAACTTTTATATTAATGGT
AGAATAACGATTGGAGAAAATGTTAATAATGACTCCAAAAAAGCTTATAAATTCTTTAAAAATCATAAGCCAGAAGAAAG
CTCAATCGCAGAATTTCAAGAAAATGGTGAAAAAGGTACTTCAGCTATACTAAATAGTAAGGCTGATATCTTATACGCAA
TAGAAATTGCCAAGGAAATGTTGTCTGATAAATCATCAGATAAGCCAATCATATACTTACCTCTAAAAGTAAACATAAAT
TCTGCTAATAATCAATTTATACCATTGAGAAATGACGATATTATCTTAATTGAAATACAGTCTTTTACTAAAGGTGAAAT
TATTGAGTTAATTTCGAACTCTGCCATATCAACAAAGAAAGCTCAGCAGCAACTACTACAACGACAACTTCTTGGATCTA
AAGAAAACTGTGAAATGGCATATACCCAAACAAGTGATAGCGAGACATTCTCACTAACTCAAGTAAATGAAGATTGTGAG
AATTCTTTTTTGATAAATGATAAAAAAGGTATTTTTCTAAGATATAAATCAAAAGGAAATTAA