Detailed information of effector


Summary

Effector ID EFF01487 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00158 experimental (Type ii)
Strain Francisella tularensis subsp. novicida U112
Replicon chromosome
Sequence Protein sequence (436 a.a.); Nucleotide sequence (1308 bp)
Description PI3K activity of OpiA can play an important role in the pathogenesis of F. novicida
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) FTN_0131 (opiA)
Coordinates (Strand) 143587..144894 (-)
NCBI ID 118496746
RefSeq NC_008601
Uniprot ID UPI0000E89733
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-435 MKNFEVIRKDFLQSIEIYINHPYKSHFLSIHHRHRDTGIRRAALLKDYILHCPNLTIMNQLIKHYLERSQELEEVLLNLKLQYKKTITKAEIKVDASLLRGGNKHPSSLWTYVNNVFQQTKNQAPIENNLSIINNPIFDVFLPVQNISKIGNSTASAHVVTRYKDKKNEKVNYFVKSLNNNEVENAIAEVIYAQIWNYFIGNRASKSLLLLSEHENKIIGIASKGISDFQEYKSLSGDQKDYPGLIQILFYVCVLIENDFHICNFGTGLFNGKRCYSKIDHDYIVSFWDALKYGKFMTEVSHNFKELFKKKSMSSLFLLLESMRFSPVKANSRILELGHKIRLGRPSTVTSHMMMSQFRNKAITRSNQKELEYTINDFILKTRPAEISRFFSDLEGVLMTKIAPLIQYNYKYLGKSNELLFFFKLRFSHLCNLLN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9979 - -



  Protein sequence: 436 a.a.    .

>EFF01487 NC_008601:c144894-143587 [Francisella tularensis subsp. novicida U112]
MKNFEVIRKDFLQSIEIYINHPYKSHFLSIHHRHRDTGIRRAALLKDYILHCPNLTIMNQLIKHYLERSQELEEVLLNLK
LQYKKTITKAEIKVDASLLRGGNKHPSSLWTYVNNVFQQTKNQAPIENNLSIINNPIFDVFLPVQNISKIGNSTASAHVV
TRYKDKKNEKVNYFVKSLNNNEVENAIAEVIYAQIWNYFIGNRASKSLLLLSEHENKIIGIASKGISDFQEYKSLSGDQK
DYPGLIQILFYVCVLIENDFHICNFGTGLFNGKRCYSKIDHDYIVSFWDALKYGKFMTEVSHNFKELFKKKSMSSLFLLL
ESMRFSPVKANSRILELGHKIRLGRPSTVTSHMMMSQFRNKAITRSNQKELEYTINDFILKTRPAEISRFFSDLEGVLMT
KIAPLIQYNYKYLGKSNELLFFFKLRFSHLCNLLN*

  Nucleotide sequence: 1308 bp    .

>EFF01487 NC_008601:c144894-143587 [Francisella tularensis subsp. novicida U112]
ATGAAAAATTTTGAAGTAATACGCAAAGATTTTCTACAGTCAATAGAAATATATATCAATCATCCATATAAGAGCCACTT
TTTAAGTATACATCACCGGCATAGGGATACCGGCATTCGAAGAGCCGCTCTATTAAAAGATTATATCTTACATTGCCCTA
ACTTAACCATAATGAATCAATTAATCAAACATTATTTAGAAAGGTCCCAAGAGCTAGAAGAGGTTCTTTTAAACCTTAAA
TTACAATATAAAAAAACAATCACTAAAGCAGAAATAAAAGTTGATGCTTCATTACTAAGAGGAGGAAATAAGCATCCAAG
TTCTTTGTGGACTTATGTTAATAATGTTTTCCAACAAACTAAGAATCAAGCTCCCATAGAAAACAATTTATCTATTATAA
ATAATCCTATTTTCGATGTTTTCTTACCTGTTCAAAATATTTCCAAAATAGGAAATTCTACTGCATCTGCACATGTAGTG
ACTCGCTATAAAGATAAAAAGAATGAAAAAGTAAACTATTTTGTTAAATCTCTTAATAATAATGAAGTTGAAAATGCAAT
TGCTGAAGTTATCTATGCTCAAATTTGGAATTATTTTATTGGAAATCGCGCTTCAAAATCTCTATTATTATTATCTGAGC
ATGAAAACAAAATTATTGGCATTGCTTCAAAAGGCATAAGTGATTTTCAAGAATATAAATCACTTAGTGGGGATCAAAAA
GATTACCCTGGACTAATACAAATTTTATTTTATGTTTGTGTGTTAATAGAAAATGATTTTCATATCTGTAATTTTGGTAC
AGGACTATTTAATGGAAAGCGGTGTTATAGTAAGATAGATCACGACTATATTGTGAGTTTTTGGGATGCTTTAAAATATG
GGAAATTTATGACAGAGGTCTCGCACAATTTTAAAGAATTATTTAAAAAAAAATCTATGTCTAGTTTATTTCTTCTTTTA
GAATCAATGCGTTTTAGTCCTGTTAAAGCAAATTCAAGAATCTTAGAATTAGGTCATAAAATACGTCTTGGAAGACCGTC
AACAGTTACTTCACATATGATGATGAGTCAATTTCGAAATAAGGCAATAACCAGGAGTAATCAAAAAGAACTTGAATATA
CAATAAATGATTTTATTCTTAAAACTAGACCTGCTGAAATTAGTAGATTTTTTTCAGATCTTGAAGGAGTTTTAATGACT
AAAATCGCTCCCCTTATTCAGTATAACTATAAATACTTAGGTAAATCCAATGAGTTATTATTCTTTTTCAAATTAAGATT
TTCTCATTTGTGTAATTTGTTGAATTAA