Detailed information of effector


Summary

Effector ID EFF01479 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00905 experimental (Type i1)
Strain Escherichia coli strain TW-XM
Replicon chromosome
Sequence Protein sequence (160 a.a.); Nucleotide sequence (480 bp)
Description Hcp2A
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) xmtA (Hcp2A)
Coordinates (Strand) 1..480 (-)
NCBI ID 611963703
GenBank KF678350
Uniprot ID Q6TKT6_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 4.2e-22 7..143

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-159 MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVTSLSHGLSRAQNVNHQELTITKPVDKSSPLLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLANARLSNIGLTVPHTINDSPGQAEESVSFTYESINWEHSVAGTSAYSLWSERIF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.5814 - -



  Protein sequence: 160 a.a.    .

>EFF01479 KF678350:c480-1 [Escherichia coli]
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVTSLSHGLSRAQNVNHQELTITKPVDKSSPLLGKAISENE
CLTCDFVFYRTNRFGINEPYYKLKLANARLSNIGLTVPHTINDSPGQAEESVSFTYESINWEHSVAGTSAYSLWSERIF*

  Nucleotide sequence: 480 bp    .

>EFF01479 KF678350:c480-1 [Escherichia coli]
ATGGCAAATCCCGTCTATCTGACACTGAACGGAGAACTTCAGGGGCTGATTTCATCCGGATGCTCGTCAATGCCGTCCAT
CGGTAACAAAGCCCAGATTGCACATCAGGATCAGATCATGGTGACGTCACTGTCCCATGGTCTGAGCCGTGCGCAGAATG
TCAACCATCAGGAGTTGACCATCACGAAACCGGTGGACAAATCCTCCCCTCTGCTGGGCAAGGCCATTTCAGAGAATGAA
TGTCTGACCTGTGATTTTGTATTCTACCGCACCAACCGCTTTGGAATTAATGAACCGTACTACAAGCTGAAACTGGCTAA
CGCCCGGCTCTCAAACATCGGCCTTACCGTTCCCCATACCATTAACGACAGTCCAGGGCAGGCGGAAGAGTCTGTGTCAT
TTACCTATGAGAGCATCAATTGGGAGCACAGCGTCGCCGGAACCAGTGCATACAGCCTTTGGAGTGAACGGATTTTCTAA