Detailed information of effector


Summary

Effector ID EFF01478 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (72 a.a.); Nucleotide sequence (216 bp)
Description The translocation of the effector is T6SS-dependent, identified from the macrophage infection-responsive E.piscicida genes
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ETAE_2136 (EseM)
Coordinates (Strand) 2248536..2248751 (+)
NCBI ID 502611987
RefSeq NC_013508
Uniprot ID D0Z9J5_EDWTE, A0A0H3DTS7_EDWTF
KEGG ID etr:ETAE_2136, etd:ETAF_1931
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
CSD PF00313.24 3.4e-33 5..69

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-71 MSNKMTGSVKWFNADKGFGFISPADGSKDVFVHFSAIQSNEFRTLDEGQQVEFSVENGPKGPSAVNVVAIN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9838 - -



  Protein sequence: 72 a.a.    .

>EFF01478 NC_013508:2248536-2248751 [Edwardsiella tarda EIB202]
MSNKMTGSVKWFNADKGFGFISPADGSKDVFVHFSAIQSNEFRTLDEGQQVEFSVENGPKGPSAVNVVAIN*

  Nucleotide sequence: 216 bp    .

>EFF01478 NC_013508:2248536-2248751 [Edwardsiella tarda EIB202]
ATGTCTAATAAAATGACTGGTTCTGTAAAATGGTTCAACGCCGATAAAGGCTTCGGCTTTATCTCCCCGGCTGATGGCAG
CAAGGACGTTTTCGTTCATTTCTCTGCCATTCAAAGCAACGAATTCCGCACTCTGGATGAAGGCCAACAGGTTGAGTTCT
CTGTAGAGAATGGTCCTAAAGGTCCTTCAGCTGTAAACGTAGTTGCTATCAACTAA