Detailed information of effector


Summary

Effector ID EFF01477 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (72 a.a.); Nucleotide sequence (216 bp)
Description The translocation of the effector is T6SS-dependent, identified from the macrophage infection-responsive E.piscicida genes
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ETAE_1303 (EseL)
Coordinates (Strand) 1411812..1412027 (-)
NCBI ID 502611166
RefSeq NC_013508
Uniprot ID D0ZG90_EDWTE, C5BDR9_EDWI9, A0A0H3DPK8_EDWTF
KEGG ID etr:ETAE_1303, eic:NT01EI_1429, etd:ETAF_1215
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
CSD PF00313.24 8.7e-31 5..70

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-71 MSNKMTGLVKWFNADKGFGFITPDNGGSDIFVHFSAIQSNGYKSLDEGQKVAFEVQTGAAKGPSAINVTPL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9830 - -



  Protein sequence: 72 a.a.    .

>EFF01477 NC_013508:c1412027-1411812 [Edwardsiella tarda EIB202]
MSNKMTGLVKWFNADKGFGFITPDNGGSDIFVHFSAIQSNGYKSLDEGQKVAFEVQTGAAKGPSAINVTPL*

  Nucleotide sequence: 216 bp    .

>EFF01477 NC_013508:c1412027-1411812 [Edwardsiella tarda EIB202]
ATGTCTAATAAAATGACTGGCTTAGTAAAATGGTTCAATGCGGATAAAGGCTTTGGTTTCATCACGCCGGATAACGGCGG
CAGCGATATCTTTGTTCATTTTTCCGCAATTCAAAGCAATGGCTACAAATCCCTGGACGAAGGCCAGAAGGTTGCATTCG
AAGTGCAAACCGGCGCAGCTAAAGGGCCGTCAGCCATTAATGTAACCCCGCTGTAA