Detailed information of effector


Summary

Effector ID EFF01475 experimental
Effector type Tne
Cognate immunity protein IMU00301 experimental
Related T6SS (Type) T6SS00035 experimental (Type i3)
Strain Pseudomonas protegens Pf-5
Replicon chromosome
Sequence Protein sequence (409 a.a.); Nucleotide sequence (1227 bp)
Description The C-terminal domain of PFL_6209 (PFL_6209tox) resembles an interbacterial NADase and depletes cellular NAD+
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PFL_6209 (Tne2)
Coordinates (Strand) 7049182..7050408 (+)
NCBI ID 68347791
RefSeq NC_004129
Uniprot ID Q4K3B6_PSEF5
KEGG ID pfl:PFL_6209
PDB ID 6B12

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PAAR_motif PF05488.15 3.2e-12 80..151

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-14 MDVQAAARLGDDIA
Transmembrane helix 15-37 HGFGVAAMLTGAVAGALIGAAII
Inside 38-43 AATAAT
Transmembrane helix 44-66 GGLAVVILAGSVAAGGLSMFQLV
Outside 67-182 KGLSTIFDLPEPTTGELIRGSPNVFVNLRNAMRAGEDVSSSCTGFPVAHPPWPFPVTIAEGSATVYINGKPAARLSSKMTCGAHIKSGSPNTFIGGPTLQVEFVLDIEGWLHTGLE
Transmembrane helix 183-205 ALGLVAAAGALVLAAMAGLAALL
Inside 206-408 TTVAVGAAIYGGMELLGQLGDRLGPGYRDLLQGIAGLALLGAGPKMAKLSAERNAARLANQSQVLEVRTAAQVNEAMVAEGNLPAWLEGTQVKTEIVPPGRQYQMVVAKGQAEAIMQGKPAFGGFAAPEPIPSQAYARDKLVILDRFKTDVSHVITVETTAPQKIHSGITGPLENYKGGVQQVEFVGDRNLKIVGTPGVLPVE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8729 - -



  Protein sequence: 409 a.a.    .

>EFF01475 NC_004129:7049182-7050408 [Pseudomonas protegens Pf-5]
MDVQAAARLGDDIAHGFGVAAMLTGAVAGALIGAAIIAATAATGGLAVVILAGSVAAGGLSMFQLVKGLSTIFDLPEPTT
GELIRGSPNVFVNLRNAMRAGEDVSSSCTGFPVAHPPWPFPVTIAEGSATVYINGKPAARLSSKMTCGAHIKSGSPNTFI
GGPTLQVEFVLDIEGWLHTGLEALGLVAAAGALVLAAMAGLAALLTTVAVGAAIYGGMELLGQLGDRLGPGYRDLLQGIA
GLALLGAGPKMAKLSAERNAARLANQSQVLEVRTAAQVNEAMVAEGNLPAWLEGTQVKTEIVPPGRQYQMVVAKGQAEAI
MQGKPAFGGFAAPEPIPSQAYARDKLVILDRFKTDVSHVITVETTAPQKIHSGITGPLENYKGGVQQVEFVGDRNLKIVG
TPGVLPVE*

  Nucleotide sequence: 1227 bp    .

>EFF01475 NC_004129:7049182-7050408 [Pseudomonas protegens Pf-5]
ATGGATGTACAGGCCGCAGCGCGGTTGGGCGACGACATCGCCCATGGATTCGGAGTTGCTGCCATGCTCACCGGCGCGGT
CGCAGGCGCTCTCATTGGCGCGGCCATCATTGCGGCGACCGCGGCAACAGGCGGCCTGGCGGTGGTGATCCTGGCGGGTT
CGGTCGCCGCCGGTGGCCTGTCGATGTTCCAGCTGGTGAAGGGGCTGTCGACCATCTTCGATCTGCCCGAGCCAACCACC
GGTGAACTCATAAGGGGCAGTCCCAACGTATTCGTCAACTTGCGCAATGCCATGCGTGCCGGCGAGGACGTGTCCAGTTC
CTGTACCGGCTTTCCCGTGGCGCATCCCCCCTGGCCCTTCCCGGTCACCATCGCCGAAGGCAGCGCTACCGTGTATATCA
ACGGCAAGCCGGCGGCGCGACTGAGCAGCAAGATGACCTGCGGCGCGCATATCAAGTCCGGTAGCCCGAACACCTTCATC
GGCGGTCCGACGCTGCAGGTGGAATTCGTGCTGGATATCGAGGGCTGGCTGCATACCGGCCTGGAGGCGCTGGGCCTGGT
CGCCGCCGCCGGCGCGCTGGTGCTGGCCGCCATGGCCGGCCTCGCGGCCCTGCTGACCACCGTGGCGGTGGGGGCCGCGA
TCTATGGCGGCATGGAGTTGCTGGGCCAGCTCGGCGACCGGCTCGGCCCGGGCTACCGCGACCTGCTGCAAGGTATCGCC
GGCCTGGCGCTGCTCGGCGCCGGGCCGAAAATGGCCAAGTTGAGCGCCGAACGCAATGCTGCGCGACTGGCCAACCAGTC
GCAGGTGCTCGAGGTGCGCACGGCCGCCCAGGTCAACGAGGCGATGGTCGCCGAGGGCAACTTGCCGGCTTGGCTGGAAG
GCACCCAGGTCAAGACCGAAATAGTGCCACCGGGAAGGCAATACCAGATGGTCGTCGCCAAGGGCCAGGCCGAAGCCATC
ATGCAGGGCAAGCCAGCCTTCGGAGGTTTCGCCGCCCCCGAGCCGATTCCCAGCCAGGCCTACGCTCGGGATAAACTGGT
GATCCTCGATCGATTCAAGACAGACGTATCCCATGTGATCACCGTCGAAACCACCGCACCGCAAAAGATTCACAGTGGTA
TCACCGGCCCGCTGGAGAACTACAAGGGCGGCGTGCAGCAGGTGGAGTTCGTCGGTGACAGGAATCTGAAAATTGTCGGC
ACGCCTGGTGTGCTGCCTGTGGAGTGA