Detailed information of effector


Summary

Effector ID EFF01474 experimental
Effector type Tde
Cognate immunity protein IMU00300 experimental
Related T6SS (Type) T6SS00035 experimental (Type i3)
Strain Pseudomonas protegens Pf-5
Replicon chromosome
Sequence Protein sequence (1487 a.a.); Nucleotide sequence (4461 bp)
Description rhsA contains an N-terminal PAAR domain, and a polymorphic C-terminal toxin domain,which belongs to a superfamily of restriction endonucleases possessing a conserved aspartic acid dyad (NCBI conserved domain accession number cl00516)
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PFL_6096 (rhsA)
Coordinates (Strand) 6925413..6929873 (+)
NCBI ID 68347678
RefSeq NC_004129
Uniprot ID Q4K3M9_PSEF5
KEGG ID pfl:PFL_6096
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 6.2e-23 304..383
RHS PF03527.16 3.6e-14 1244..1280
RHS_repeat PF05593.16 2.4e-08 673..709
PAAR_motif PF05488.15 1.3e-07 182..226
RHS_repeat PF05593.16 2e-07 799..835
RHS_repeat PF05593.16 1.6e-06 736..773
RHS_repeat PF05593.16 1.9e-06 614..644
RHS_repeat PF05593.16 1.7e-05 499..535

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-22 MSDALWAARLGDGLEHTSMMAD
Transmembrane helix 23-45 ILGGVLEVAANVAIGALATMAVA
Inside 46-51 AAAGIT
Transmembrane helix 52-74 VATGGLGACVLGLVVGVVVGVVM
Outside 75-1486 SKTGADKGLSNLCEGIANALFPPSIQATIASGSKKVLTNNKPAARAAGIAPPTQISGDGAEEGEATDTPSATPEEGPGFLDMAKEFFSQMWRPTVASPAPGSQTKELDLVTCTKHPPMPVQYLAEGSEKVSIDGQPAVRSGDRSTCDAKVVSAGPISPNVTIGGGSVVVREIRSGKTPGVGLAVTVLMMLKGGKGKFLSNLPCMLMAGVNSFVVSQATNALTQAVVASTHPVHAATGAKVLGADDDLDFTLPGLMPIEWQRFYNSRDERRDGLLGAGWSLPYEISVQIEPHPEGGERLLYIDEQGRRIDMGSIALGAGAFSPGEGLSVRRNENGQLLIESSDGIYRLFEPLPGDSSRLRLSLLGDRNDNRLHLEYDSSGRLWLLRDTFEQAQLELSYSTLWPGRIAQVERLYPDQQREVLVSYDYDAAGDLAQVRDSEGQVQRRFAYDAGHRMIEHQLATGLRCFYQWTQFADQQWRVTRHWTDEGDSYQYDYDLEAGITQVTDSLQRLSRRRWNSQLQIVEYTDNLNQTWAFEWNDERQLLSATDPLGGRYAYSYDETGNLIAETDPLGHSHSTLWLEHWSLPQTLTDPAGESWHLRYDPRGNCIAEVDPLGQVTQYRHDAHGQVVEIIDAAGRSRKMRWNSSGQLLEHLDCSGYPTRFEYDRRGNVKAIIDALGEHTRFHYDCQGRLLSSQLADGRAEHFQRSSNGQLQGYTDPSGYTTLYQYNRRGQIRQRIDAHGRQVRFDYDAYGRLLALTNENGESYRFAWDAGNRLSEQQDLDGSAKRYGYDLLNNVVELQSHPAPYGTGLSAVPAQPIAPIIHRFERDAVGRLLAKITDDGRSQYTYDPLNQLTAASFTDNLGNQQALSFSYDALGQLLEEHTVAGSLIHRYDELGNLTQTQLPDKRWLNRLYYGSGHLHQINLDGQVVSDFQRDRLHREVLRTQGQISTRSEYDRCGRLRARLQHSSLLANTLPTAPERHLEYDDSDNLVGLAERHATGQHRQLFHYDATGRIIASQDGLQGQKETFAYDAAANLLDGPKAGAGLVVHNKLLTYQDKRYRYDAFGRMIEKRSGRRGVQRFAYDAEHRLIEVRNQTSSGETLVRMRYDVLGRRISKSEYDSQGNLLGETRFVWDGLRLLQEQRNQQTSLYVYEDLGHAPLARVDGLGAQQKIRYYHNDLNGLPQQLCEPDGHSVWQARYQVWGNTVEEIREPYYIEEQNLRFQGQYLDRETGLHFNTFRFYDPDIGRFTTPDPIGLAGGLNLYQYAPNPIGWIDPLGWICKSAYSGRRGTTKAKADLERNGFTVVGEELTMKVKHPVTQKSYRIRADIIAKDKAGNYHVFEVKNGSGKLTKNQQGSGMFDMSNPANTNGGLGGGLIKPSGATQGQFEVATKTARGTQFGGNGAQHSATFWLLRY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9647 - -



  Protein sequence: 1487 a.a.    .

>EFF01474 NC_004129:6925413-6929873 [Pseudomonas protegens Pf-5]
MSDALWAARLGDGLEHTSMMADILGGVLEVAANVAIGALATMAVAAAAGITVATGGLGACVLGLVVGVVVGVVMSKTGAD
KGLSNLCEGIANALFPPSIQATIASGSKKVLTNNKPAARAAGIAPPTQISGDGAEEGEATDTPSATPEEGPGFLDMAKEF
FSQMWRPTVASPAPGSQTKELDLVTCTKHPPMPVQYLAEGSEKVSIDGQPAVRSGDRSTCDAKVVSAGPISPNVTIGGGS
VVVREIRSGKTPGVGLAVTVLMMLKGGKGKFLSNLPCMLMAGVNSFVVSQATNALTQAVVASTHPVHAATGAKVLGADDD
LDFTLPGLMPIEWQRFYNSRDERRDGLLGAGWSLPYEISVQIEPHPEGGERLLYIDEQGRRIDMGSIALGAGAFSPGEGL
SVRRNENGQLLIESSDGIYRLFEPLPGDSSRLRLSLLGDRNDNRLHLEYDSSGRLWLLRDTFEQAQLELSYSTLWPGRIA
QVERLYPDQQREVLVSYDYDAAGDLAQVRDSEGQVQRRFAYDAGHRMIEHQLATGLRCFYQWTQFADQQWRVTRHWTDEG
DSYQYDYDLEAGITQVTDSLQRLSRRRWNSQLQIVEYTDNLNQTWAFEWNDERQLLSATDPLGGRYAYSYDETGNLIAET
DPLGHSHSTLWLEHWSLPQTLTDPAGESWHLRYDPRGNCIAEVDPLGQVTQYRHDAHGQVVEIIDAAGRSRKMRWNSSGQ
LLEHLDCSGYPTRFEYDRRGNVKAIIDALGEHTRFHYDCQGRLLSSQLADGRAEHFQRSSNGQLQGYTDPSGYTTLYQYN
RRGQIRQRIDAHGRQVRFDYDAYGRLLALTNENGESYRFAWDAGNRLSEQQDLDGSAKRYGYDLLNNVVELQSHPAPYGT
GLSAVPAQPIAPIIHRFERDAVGRLLAKITDDGRSQYTYDPLNQLTAASFTDNLGNQQALSFSYDALGQLLEEHTVAGSL
IHRYDELGNLTQTQLPDKRWLNRLYYGSGHLHQINLDGQVVSDFQRDRLHREVLRTQGQISTRSEYDRCGRLRARLQHSS
LLANTLPTAPERHLEYDDSDNLVGLAERHATGQHRQLFHYDATGRIIASQDGLQGQKETFAYDAAANLLDGPKAGAGLVV
HNKLLTYQDKRYRYDAFGRMIEKRSGRRGVQRFAYDAEHRLIEVRNQTSSGETLVRMRYDVLGRRISKSEYDSQGNLLGE
TRFVWDGLRLLQEQRNQQTSLYVYEDLGHAPLARVDGLGAQQKIRYYHNDLNGLPQQLCEPDGHSVWQARYQVWGNTVEE
IREPYYIEEQNLRFQGQYLDRETGLHFNTFRFYDPDIGRFTTPDPIGLAGGLNLYQYAPNPIGWIDPLGWICKSAYSGRR
GTTKAKADLERNGFTVVGEELTMKVKHPVTQKSYRIRADIIAKDKAGNYHVFEVKNGSGKLTKNQQGSGMFDMSNPANTN
GGLGGGLIKPSGATQGQFEVATKTARGTQFGGNGAQHSATFWLLRY*

  Nucleotide sequence: 4461 bp    .

>EFF01474 NC_004129:6925413-6929873 [Pseudomonas protegens Pf-5]
ATGTCTGACGCACTGTGGGCCGCCCGCCTGGGTGACGGGCTGGAACACACCTCGATGATGGCCGACATTCTCGGCGGTGT
GCTGGAGGTGGCGGCCAACGTTGCCATCGGCGCCCTGGCGACCATGGCAGTAGCCGCGGCGGCAGGCATCACCGTGGCCA
CCGGCGGCCTCGGCGCCTGTGTGCTGGGGCTGGTGGTGGGCGTCGTCGTCGGCGTGGTCATGAGCAAGACCGGAGCCGAC
AAGGGCCTGAGCAATTTATGCGAGGGTATCGCCAACGCCCTGTTCCCGCCCTCGATCCAGGCCACCATCGCCAGCGGCTC
GAAAAAGGTCCTGACCAACAACAAGCCGGCGGCCCGCGCGGCCGGCATCGCACCGCCGACACAGATCAGCGGCGACGGCG
CCGAAGAAGGCGAAGCCACCGACACCCCGTCGGCAACGCCCGAGGAAGGGCCCGGTTTCCTCGACATGGCCAAGGAGTTT
TTCTCGCAGATGTGGCGGCCCACCGTGGCCTCCCCGGCGCCAGGCTCCCAGACCAAGGAACTGGACCTGGTGACCTGCAC
CAAGCACCCGCCGATGCCGGTGCAGTATCTGGCTGAAGGCTCGGAAAAGGTCAGCATCGACGGCCAGCCGGCAGTACGCA
GCGGCGACCGCAGCACCTGCGATGCCAAGGTAGTGTCGGCCGGGCCTATCTCCCCGAACGTGACCATCGGCGGTGGCTCG
GTGGTGGTGCGCGAGATCCGTAGCGGCAAGACCCCGGGGGTGGGCCTGGCGGTGACCGTGCTGATGATGCTCAAGGGCGG
CAAGGGCAAGTTCCTCAGCAACCTGCCGTGCATGCTGATGGCCGGGGTCAATTCCTTTGTCGTCAGCCAGGCCACCAATG
CTTTGACCCAGGCCGTCGTCGCCTCGACCCACCCGGTGCATGCAGCCACCGGGGCCAAGGTGCTCGGAGCCGACGACGAT
CTGGATTTCACCCTGCCCGGGCTGATGCCCATCGAATGGCAACGCTTCTACAACAGCCGCGACGAACGTCGTGACGGCCT
GCTCGGGGCCGGCTGGAGCTTGCCTTACGAGATCAGCGTCCAGATCGAGCCCCACCCCGAAGGTGGCGAGCGTCTGCTCT
ACATTGATGAGCAAGGACGCCGCATCGACATGGGCTCCATTGCCCTGGGTGCAGGAGCCTTCAGCCCCGGTGAAGGCTTG
AGCGTGCGACGCAACGAGAACGGACAGTTGCTGATCGAAAGCAGCGACGGTATCTACCGTCTGTTCGAGCCGCTGCCGGG
CGACTCCTCGCGGCTGCGCCTGAGCCTGCTGGGGGACCGCAACGACAACCGTCTGCACCTGGAGTACGACTCGTCCGGAC
GCCTCTGGCTGCTGCGTGACACCTTTGAACAGGCGCAGCTCGAACTGAGCTACAGCACGCTCTGGCCCGGTCGGATTGCC
CAGGTCGAACGGCTGTACCCCGACCAGCAACGGGAAGTGCTGGTCAGCTATGACTACGATGCGGCAGGAGACCTGGCACA
GGTGCGCGATAGCGAAGGCCAGGTACAGCGTCGCTTCGCTTATGACGCCGGCCACCGGATGATCGAACATCAATTGGCCA
CCGGGCTGCGCTGCTTCTATCAATGGACACAATTTGCCGACCAGCAGTGGCGAGTGACCCGTCACTGGACCGACGAAGGC
GATAGCTATCAGTACGACTATGATCTGGAGGCGGGAATCACCCAGGTCACCGACAGCCTGCAACGCCTCAGCCGCCGCCG
CTGGAACAGCCAGTTGCAGATCGTCGAGTACACCGACAACCTCAACCAGACATGGGCCTTCGAGTGGAACGATGAGCGCC
AACTGCTCAGCGCCACCGACCCCTTGGGAGGGCGCTATGCCTATAGCTACGACGAAACCGGCAACCTGATAGCCGAGACC
GATCCTCTGGGGCACAGCCATTCGACCTTGTGGCTGGAGCACTGGTCGCTGCCACAGACCCTGACCGATCCCGCCGGAGA
AAGCTGGCACCTGCGCTACGATCCCCGGGGCAACTGTATCGCCGAAGTAGACCCGCTGGGCCAGGTGACCCAGTACCGCC
ATGACGCGCACGGCCAGGTGGTGGAGATCATCGATGCCGCGGGAAGAAGCCGGAAGATGCGCTGGAACTCGTCCGGGCAA
TTGCTTGAACACCTGGACTGCTCGGGCTATCCAACCCGCTTCGAATACGATCGACGCGGCAACGTGAAAGCCATCATCGA
TGCCCTTGGCGAGCACACCCGGTTCCATTACGACTGCCAGGGACGGTTGCTGAGCAGCCAACTGGCCGATGGGCGCGCCG
AGCATTTTCAACGCAGCAGCAACGGCCAGCTACAGGGCTACACCGACCCTTCCGGCTACACCACGCTCTACCAGTACAAC
CGGCGCGGGCAGATACGCCAGCGCATCGACGCTCACGGCCGACAGGTCCGGTTCGACTATGACGCGTACGGACGGCTGCT
GGCGCTCACCAACGAGAACGGCGAAAGCTATCGCTTTGCCTGGGACGCCGGCAACCGCCTGAGCGAACAGCAGGACCTCG
ACGGCAGTGCCAAACGCTATGGCTATGACCTGCTGAACAACGTCGTCGAACTCCAGTCCCACCCCGCCCCTTATGGCACC
GGGCTGAGCGCCGTGCCCGCGCAACCTATCGCGCCGATCATCCACCGGTTCGAGCGCGATGCCGTGGGGCGGCTGCTGGC
CAAAATCACAGACGATGGCCGCAGCCAATACACCTACGACCCCTTGAACCAACTGACCGCCGCCAGCTTTACCGACAACC
TCGGCAACCAGCAGGCACTGAGTTTCAGCTACGACGCCCTGGGCCAATTACTCGAAGAACACACCGTGGCCGGCAGCCTG
ATCCATCGATACGACGAACTGGGCAATTTGACTCAGACCCAGCTACCGGACAAGCGTTGGCTCAACCGGCTCTATTACGG
CAGCGGCCATCTGCACCAGATCAATCTCGATGGCCAGGTAGTCAGCGACTTTCAACGTGACCGCCTGCACCGTGAGGTGC
TGCGCACCCAGGGTCAGATCAGCACTCGCAGCGAATACGACCGGTGTGGCCGCCTGCGCGCACGCCTGCAGCATTCCAGC
CTGCTGGCAAACACCTTGCCAACAGCCCCGGAGCGACACCTGGAGTACGACGATAGCGATAATCTGGTGGGCCTGGCCGA
GCGACATGCCACCGGGCAACATCGGCAACTGTTCCATTACGACGCGACCGGGCGAATCATTGCCAGCCAGGACGGCCTGC
AGGGCCAGAAAGAAACCTTCGCCTATGACGCCGCCGCCAATTTGCTTGATGGCCCGAAGGCGGGCGCCGGGCTGGTGGTG
CACAACAAATTGCTGACCTACCAGGACAAGCGCTACCGCTACGATGCCTTCGGGCGAATGATTGAAAAACGCAGTGGTCG
GCGAGGCGTGCAACGTTTTGCCTACGACGCCGAACACCGGTTGATCGAAGTGCGCAATCAGACCTCCAGCGGCGAAACCC
TGGTCAGGATGCGCTACGACGTCTTGGGTCGCCGCATCAGCAAGAGCGAGTACGACAGCCAGGGCAACCTTCTGGGTGAA
ACGCGATTCGTCTGGGATGGCCTGCGGCTGCTGCAGGAACAGCGTAATCAACAGACCAGCCTCTATGTCTATGAAGACCT
GGGACATGCGCCCCTGGCGCGGGTCGACGGCCTTGGCGCGCAGCAGAAGATCCGCTACTACCACAACGACCTGAATGGCC
TGCCTCAACAGCTTTGCGAGCCTGACGGCCATAGCGTCTGGCAGGCCCGCTATCAGGTCTGGGGCAATACTGTCGAAGAA
ATACGCGAGCCCTACTACATCGAGGAACAGAATCTCAGGTTCCAGGGCCAGTACCTGGACCGCGAGACTGGATTGCACTT
CAACACGTTCCGTTTCTACGACCCGGATATCGGGCGCTTCACCACGCCGGACCCCATCGGCCTGGCCGGAGGCTTGAACC
TTTATCAGTACGCTCCCAACCCAATCGGTTGGATCGATCCGCTGGGCTGGATCTGCAAATCGGCCTACAGCGGCAGAAGG
GGCACTACAAAAGCCAAAGCTGACCTCGAGAGGAACGGTTTCACTGTGGTAGGTGAAGAATTGACCATGAAGGTCAAACA
CCCTGTCACCCAGAAGTCCTATCGCATCAGGGCAGATATCATCGCCAAGGACAAAGCCGGCAACTACCACGTGTTCGAAG
TCAAAAATGGCAGCGGCAAACTGACCAAGAACCAACAGGGATCGGGAATGTTCGACATGAGCAATCCGGCCAATACTAAC
GGTGGCCTGGGCGGTGGCCTGATCAAACCGTCGGGCGCTACCCAAGGCCAGTTCGAAGTTGCGACCAAAACCGCCAGAGG
TACCCAGTTCGGTGGCAATGGCGCACAGCATTCGGCCACCTTCTGGCTTCTTCGCTATTGA