Detailed information of effector


Summary

Effector ID EFF01470 experimental
Effector type Tae
Cognate immunity protein IMU00294 experimental
Related T6SS (Type) T6SS00061 experimental (Type i4b)
Strain Acinetobacter baylyi ADP1
Replicon chromosome
Sequence Protein sequence (728 a.a.); Nucleotide sequence (2184 bp)
Description Tae1 (ACIAD0168) is a T6SS effector validated by experiment and it putatively functions as peptidoglycan-hydrolyzing amidase by bioinformatic analysis.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ACIAD_RS00785
Coordinates (Strand) 170197..172380 (+)
NCBI ID 50083453
RefSeq NC_005966
Uniprot ID UPI00003B72D1
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
LysM PF01476.22 1.3e-13 112..155
Hydrolase_2 PF07486.14 1.1e-05 583..680

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-727 VNKKSLVTIQLLDLFGSPISKAQYEVKNQRTGQVIAAGFTNSSGCIVEISRDKGTALDVYIKSMFNGLMIKIQSFVMFKDRMLVKITSPKVMLDLKTLTNQGDNGQYKRKTHVVKKGETLFEIAQKNHTTVRALERLNKIDDPNKISIGQVIKLPVNIPATGNNSHQEKAKQTTQQRTQPSASSTKTKAPQTPPTRPSSITPQKKQEEGIFGANFGSKILDQVNELYEEGKKTLNEATNAASKILTVDDRSQDGGTPKADAPNLCKTNPQCISSGKSELIREVNIRLAGFGGALPTDEFTELTANCIKQFQRDYMGVPETGKICGSVLVALDKFYEEYPIAGFMGKAACNCGKCSGFGNGNMGVPSGSNKANEYPGLHRSLIWILKAINFYLKNEFKEKKIEVAYIESGYRCIENNKKHGRATVNHMGLALDIHFNKNGRRTREVNDMEFIRKQIMVKKMGASESREVDKIYLEPKVFNSGTSGATTWVHFDVTKFSAIYFSGNIFQKTIVELNGVKMFTLVNSLKVPRILSCGGGGSTQKPHDTIVGGELVLSNDDIIDIMKVTETEVIKFKTEKYFTDQAAGVVDTIMNRVKSGVWGDSIRSVVNADRQFSKITGPKSLDPYGSVEKMPISHVSTRIRNFVNSYLIERANGKLSIIGENLNYANKYYSDAKNRKAWVDKFHDEAVKKGMILGNGTAIHAHGTTTELRNKMPKPFKIVLPKNFKGI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.7077 pos: 22-23. SKA-QY. VNKKSLVTIQLLDLFGSPISKA



  Protein sequence: 728 a.a.    .

>EFF01470 NC_005966:170197-172380 [Acinetobacter baylyi ADP1]
VNKKSLVTIQLLDLFGSPISKAQYEVKNQRTGQVIAAGFTNSSGCIVEISRDKGTALDVYIKSMFNGLMIKIQSFVMFKD
RMLVKITSPKVMLDLKTLTNQGDNGQYKRKTHVVKKGETLFEIAQKNHTTVRALERLNKIDDPNKISIGQVIKLPVNIPA
TGNNSHQEKAKQTTQQRTQPSASSTKTKAPQTPPTRPSSITPQKKQEEGIFGANFGSKILDQVNELYEEGKKTLNEATNA
ASKILTVDDRSQDGGTPKADAPNLCKTNPQCISSGKSELIREVNIRLAGFGGALPTDEFTELTANCIKQFQRDYMGVPET
GKICGSVLVALDKFYEEYPIAGFMGKAACNCGKCSGFGNGNMGVPSGSNKANEYPGLHRSLIWILKAINFYLKNEFKEKK
IEVAYIESGYRCIENNKKHGRATVNHMGLALDIHFNKNGRRTREVNDMEFIRKQIMVKKMGASESREVDKIYLEPKVFNS
GTSGATTWVHFDVTKFSAIYFSGNIFQKTIVELNGVKMFTLVNSLKVPRILSCGGGGSTQKPHDTIVGGELVLSNDDIID
IMKVTETEVIKFKTEKYFTDQAAGVVDTIMNRVKSGVWGDSIRSVVNADRQFSKITGPKSLDPYGSVEKMPISHVSTRIR
NFVNSYLIERANGKLSIIGENLNYANKYYSDAKNRKAWVDKFHDEAVKKGMILGNGTAIHAHGTTTELRNKMPKPFKIVL
PKNFKGI*

  Nucleotide sequence: 2184 bp    .

>EFF01470 NC_005966:170197-172380 [Acinetobacter baylyi ADP1]
GTGAATAAAAAATCACTAGTTACGATACAACTCTTAGATTTATTTGGTAGTCCAATCTCAAAAGCACAATATGAAGTAAA
AAATCAGAGGACTGGGCAAGTTATTGCTGCTGGATTTACGAATTCGTCTGGATGTATCGTTGAGATTAGTCGAGATAAAG
GTACGGCTTTAGATGTTTATATCAAAAGTATGTTTAATGGCTTGATGATCAAGATACAAAGTTTTGTAATGTTTAAAGAT
CGCATGCTCGTAAAAATTACCAGTCCAAAAGTAATGTTGGATTTAAAAACATTAACAAATCAAGGTGATAATGGACAATA
TAAAAGAAAAACGCATGTTGTAAAAAAGGGTGAAACTTTATTTGAAATAGCTCAAAAAAATCATACTACTGTTCGAGCAT
TAGAGCGTTTGAATAAAATAGATGACCCTAATAAGATTAGTATTGGGCAAGTGATTAAGTTGCCAGTGAATATTCCTGCG
ACAGGAAATAATTCACATCAAGAAAAAGCGAAACAGACCACTCAGCAGAGAACACAACCTTCGGCTAGCAGCACTAAAAC
AAAAGCACCACAGACTCCGCCTACAAGGCCATCGAGTATAACACCTCAGAAAAAGCAGGAAGAAGGAATTTTTGGAGCAA
ATTTTGGCAGTAAAATCCTCGACCAAGTGAATGAGCTTTATGAAGAAGGTAAAAAAACGCTGAATGAAGCTACAAACGCT
GCTTCCAAAATATTGACGGTTGATGATCGCAGTCAGGATGGTGGGACACCTAAAGCAGATGCTCCAAATTTATGTAAAAC
TAATCCGCAATGTATTTCAAGTGGTAAGAGTGAGCTTATTCGAGAAGTAAATATTCGTTTAGCAGGCTTCGGTGGAGCTT
TACCTACGGATGAGTTTACCGAACTGACTGCAAATTGTATTAAGCAATTCCAACGGGATTATATGGGGGTACCAGAGACG
GGGAAAATTTGTGGTTCAGTATTGGTAGCGTTGGATAAATTTTATGAAGAATACCCTATTGCAGGTTTTATGGGGAAAGC
TGCTTGTAATTGTGGCAAATGTTCGGGCTTTGGTAATGGTAATATGGGGGTTCCATCTGGTTCAAATAAAGCAAATGAAT
ATCCAGGATTACACCGAAGTCTAATCTGGATATTAAAGGCTATAAATTTTTATTTAAAAAATGAATTTAAGGAAAAGAAA
ATCGAAGTAGCTTATATAGAGTCTGGTTATAGATGTATTGAAAATAATAAAAAACATGGAAGAGCAACAGTAAATCATAT
GGGTTTAGCTCTGGATATTCATTTTAATAAGAATGGACGTAGGACTCGTGAAGTCAATGATATGGAATTTATTCGTAAAC
AAATTATGGTTAAAAAAATGGGAGCATCTGAAAGTAGAGAGGTTGATAAAATTTATTTAGAACCAAAAGTTTTTAATAGT
GGGACTTCAGGAGCAACTACATGGGTACATTTTGATGTTACTAAATTCTCAGCTATATATTTTAGTGGAAATATTTTTCA
AAAAACAATAGTTGAATTAAATGGCGTTAAAATGTTTACTCTAGTAAACAGCTTGAAAGTTCCTAGGATTTTAAGTTGTG
GAGGGGGGGGCTCAACACAAAAACCACATGATACTATAGTGGGGGGTGAACTAGTACTAAGTAATGATGATATTATAGAT
ATTATGAAAGTAACTGAGACTGAGGTGATAAAGTTTAAAACAGAGAAATATTTTACTGATCAAGCTGCTGGTGTTGTAGA
TACTATTATGAATAGAGTCAAGTCTGGTGTATGGGGGGATAGTATCAGAAGTGTAGTTAATGCTGATAGACAGTTTTCTA
AAATTACAGGTCCTAAAAGTTTAGACCCTTATGGTAGTGTTGAAAAAATGCCAATATCGCATGTAAGTACAAGGATTAGG
AATTTTGTTAATAGCTATCTTATAGAAAGAGCAAATGGTAAACTTTCCATTATTGGAGAAAATCTAAACTATGCAAATAA
ATATTATTCAGATGCAAAAAATAGAAAGGCATGGGTAGATAAATTTCATGATGAAGCGGTCAAGAAAGGTATGATACTTG
GCAATGGAACAGCTATACATGCTCATGGCACTACGACTGAATTAAGAAATAAAATGCCAAAACCTTTTAAAATAGTTCTC
CCTAAAAACTTCAAAGGAATTTAA