Detailed information of effector


Summary

Effector ID EFF01467 experimental
Effector type Tde
Cognate immunity protein -
Related T6SS (Type) T6SS00237 insolico (Type i2)
Strain Salmonella enterica subsp. arizonae serovar 62:z4z23:-
Replicon chromosome
Sequence Protein sequence (1197 a.a.); Nucleotide sequence (3591 bp)
Description V. cholerae VgrG3 fused to the predicted nuclease domain of the S. arizonae VgrG-NucSe1
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SARI_02603
Coordinates (Strand) 2520159..2523749 (-)
NCBI ID 160865837
RefSeq NC_010067
Uniprot ID A9MMY5_SALAR
KEGG ID ses:SARI_02603
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 2.7e-57 33..339
Pyocin_S PF06958.14 1e-37 912..1053
DUF2345 PF10106.11 4.6e-34 603..727
T6SS_Vgr PF13296.8 1.7e-32 476..575
Phage_base_V PF04717.14 5.7e-08 390..456

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1196 MDNWLALFDGQTRYFLDINDSSVKPDVLRFYGREALSEPFRWDIEFTTLQANIPPEQVLMKYASFRMRSGKSVHGMVTRLEWLSTSKDQSHYRLTLSSRLALLGYTRQCAVYQNQSVPEVVEQVLRKHGLEGPDFEFRLEHTYPPREIITQWQETDLQFIQRILSEVGIYWRTMMDDVRDLDTYIFADSQLNYQFDVRLPYSEPSGLFDGAAESVWDVRTWHNIATGTVVTRDYNYRTATTPMDAAVSVRSDAVTTGEHYRYAAPYREAGDDASPEPETESGAFYARLHHERELNRSARIHLFSNAAHLTPGQVLEPQGDVITALQEGVFLTLVTFRGARDSRLHVSVWGQPYTERYCFRPVEIPRPVIPGTLPARIESREKNDTYAHLDEQGRYRVKLDFDREGTESGYGYLWLRMAKPYAGDTLGWHTPLTDGTEVAIAYSNGDIDLPYIAYALHDSEHPDHVNRDNHTRNVLRTPANNKLRMEDRRGEEHIKLATEYGKTQLNSGHLVNSKGETRGRGAELRTDEWGTLRAGKGLFVSADAQAKAQGEVLDMSAALEEIDRLNQQLQQMEIAAEQAQALKADVDSQIRMFEQRLKPLSEALLMSAPEGMALTSGEHMQMTATKNVAINAGGDASIGAMGNMTALAGDKLGLFARTGQLSMKASEGPVEMQAQNAAMRLFAEKKLTMSSASDISFAGKKRITLVGGGSYLRLEAGKVEYGTTASYLRKVKRTMAASASAKPVQAVSLPPPATMREFNPETLAPWVTPVYAKSCLKEKGCTDAGTAEEPVDNFGQMTIFAQPVEDDCCGYGHQHEHADDEVVQHAQSAKKRKPDAGGENAPAQATAAPLALGAATGLMTQVWGEWSLTGALGAARGIPYVGAMMSALYVPSAGEGSDRVPGRDEFWYEEELRQKSLTGAKATTRVRFFWRQDEQGNMRVYGVHTGEGTPYEGVRTAEMKWVEKNSRYEFKPAHGADVPLITWTPERPEGGDLPAHTGSDIKPIDQATILVTPIPDGKDEYTTPPFPMPEERDLNDYILVFPAGSGIKPVYVYLKDDSRNQPGTATGNGVKLSGDKPWLDLSVTNKGNGAPIPSHIADKLRGRSYGSFDDLREDLWEEISNDPKLMAQFGEDNQERISNGLAPWVPSDGYYHGPNEVVKKFQIHHDQAIEDGGGVYDLDNLRIVTPRLHDEIHYRR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9964 - -



  Protein sequence: 1197 a.a.    .

>EFF01467 NC_010067:c2523749-2520159 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-]
MDNWLALFDGQTRYFLDINDSSVKPDVLRFYGREALSEPFRWDIEFTTLQANIPPEQVLMKYASFRMRSGKSVHGMVTRL
EWLSTSKDQSHYRLTLSSRLALLGYTRQCAVYQNQSVPEVVEQVLRKHGLEGPDFEFRLEHTYPPREIITQWQETDLQFI
QRILSEVGIYWRTMMDDVRDLDTYIFADSQLNYQFDVRLPYSEPSGLFDGAAESVWDVRTWHNIATGTVVTRDYNYRTAT
TPMDAAVSVRSDAVTTGEHYRYAAPYREAGDDASPEPETESGAFYARLHHERELNRSARIHLFSNAAHLTPGQVLEPQGD
VITALQEGVFLTLVTFRGARDSRLHVSVWGQPYTERYCFRPVEIPRPVIPGTLPARIESREKNDTYAHLDEQGRYRVKLD
FDREGTESGYGYLWLRMAKPYAGDTLGWHTPLTDGTEVAIAYSNGDIDLPYIAYALHDSEHPDHVNRDNHTRNVLRTPAN
NKLRMEDRRGEEHIKLATEYGKTQLNSGHLVNSKGETRGRGAELRTDEWGTLRAGKGLFVSADAQAKAQGEVLDMSAALE
EIDRLNQQLQQMEIAAEQAQALKADVDSQIRMFEQRLKPLSEALLMSAPEGMALTSGEHMQMTATKNVAINAGGDASIGA
MGNMTALAGDKLGLFARTGQLSMKASEGPVEMQAQNAAMRLFAEKKLTMSSASDISFAGKKRITLVGGGSYLRLEAGKVE
YGTTASYLRKVKRTMAASASAKPVQAVSLPPPATMREFNPETLAPWVTPVYAKSCLKEKGCTDAGTAEEPVDNFGQMTIF
AQPVEDDCCGYGHQHEHADDEVVQHAQSAKKRKPDAGGENAPAQATAAPLALGAATGLMTQVWGEWSLTGALGAARGIPY
VGAMMSALYVPSAGEGSDRVPGRDEFWYEEELRQKSLTGAKATTRVRFFWRQDEQGNMRVYGVHTGEGTPYEGVRTAEMK
WVEKNSRYEFKPAHGADVPLITWTPERPEGGDLPAHTGSDIKPIDQATILVTPIPDGKDEYTTPPFPMPEERDLNDYILV
FPAGSGIKPVYVYLKDDSRNQPGTATGNGVKLSGDKPWLDLSVTNKGNGAPIPSHIADKLRGRSYGSFDDLREDLWEEIS
NDPKLMAQFGEDNQERISNGLAPWVPSDGYYHGPNEVVKKFQIHHDQAIEDGGGVYDLDNLRIVTPRLHDEIHYRR*

  Nucleotide sequence: 3591 bp    .

>EFF01467 NC_010067:c2523749-2520159 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-]
ATGGATAACTGGTTAGCGCTTTTTGACGGACAGACCCGATATTTTCTGGATATCAATGACAGTTCAGTGAAGCCGGATGT
TCTGCGCTTTTACGGCAGGGAAGCACTGAGCGAACCATTCCGCTGGGACATCGAGTTCACCACGCTTCAGGCGAATATCC
CCCCGGAACAGGTGCTGATGAAATATGCCTCCTTCCGGATGCGGAGCGGCAAAAGTGTGCACGGCATGGTGACCCGCCTG
GAATGGCTTTCCACCTCAAAGGACCAGTCTCACTACCGTCTTACGCTCAGTTCGCGCCTGGCACTCCTGGGATACACCCG
ACAGTGCGCGGTATATCAGAACCAGTCCGTTCCTGAGGTGGTTGAGCAGGTGCTGCGTAAACACGGTCTGGAAGGTCCAG
ATTTTGAATTCAGACTGGAGCATACGTACCCGCCGCGTGAAATTATCACTCAGTGGCAGGAGACGGATCTGCAATTCATC
CAGCGTATTTTGTCTGAGGTGGGAATTTACTGGCGCACGATGATGGACGATGTGCGCGATCTGGATACGTACATTTTTGC
CGACAGCCAGCTTAACTACCAGTTTGATGTGCGCCTGCCGTACAGCGAGCCATCGGGTCTGTTCGACGGCGCGGCAGAAT
CGGTCTGGGATGTGCGGACCTGGCACAACATAGCCACCGGCACTGTCGTCACGCGGGATTACAACTACCGGACCGCCACC
ACGCCGATGGATGCGGCGGTGAGTGTGCGCAGTGATGCGGTCACCACCGGGGAGCATTACCGCTACGCGGCACCTTATCG
TGAAGCGGGCGATGACGCCAGCCCGGAGCCGGAAACCGAATCTGGCGCGTTCTACGCCCGACTTCACCACGAGCGGGAGC
TCAACAGGTCGGCCCGCATTCACCTGTTCAGCAATGCTGCACACCTCACTCCCGGGCAGGTGCTGGAGCCGCAGGGCGAC
GTCATTACGGCCCTGCAAGAAGGCGTGTTCCTCACGCTGGTGACCTTCCGTGGCGCCCGTGATTCCCGTCTGCATGTGTC
AGTCTGGGGCCAGCCTTACACCGAACGTTACTGCTTCCGTCCGGTAGAGATCCCTCGCCCGGTCATCCCGGGTACGCTTC
CGGCCCGGATCGAAAGTCGCGAAAAAAATGATACCTACGCCCACCTGGACGAGCAGGGGCGCTATCGGGTGAAACTGGAC
TTCGACCGGGAGGGGACGGAATCCGGTTACGGTTACCTGTGGCTGCGGATGGCGAAGCCGTACGCCGGTGACACGCTGGG
CTGGCATACGCCGCTCACCGACGGAACCGAAGTGGCGATTGCGTACAGCAACGGTGATATTGACCTGCCGTACATCGCGT
ATGCGCTTCACGACTCAGAACATCCGGACCATGTGAACCGGGACAACCACACCCGCAACGTGCTGCGCACCCCGGCGAAT
AACAAGCTGCGGATGGAAGACAGGCGCGGGGAAGAGCACATCAAACTCGCCACGGAGTACGGCAAGACGCAGCTCAACAG
CGGGCACCTGGTGAACAGCAAGGGAGAGACTCGCGGCAGAGGCGCAGAGCTGCGCACCGACGAGTGGGGAACACTGCGAG
CCGGAAAGGGGCTGTTTGTCAGCGCCGACGCGCAGGCGAAGGCACAGGGCGAGGTGCTGGATATGAGCGCCGCGCTGGAG
GAAATCGACAGGCTCAACCAGCAGTTGCAGCAGATGGAAATCGCGGCAGAGCAGGCGCAGGCGCTGAAGGCGGATGTGGA
CAGCCAGATACGGATGTTTGAGCAGCGGCTGAAGCCGCTCAGTGAGGCGCTGCTGATGTCCGCCCCGGAAGGGATGGCGC
TGACCAGCGGGGAGCATATGCAGATGACGGCCACGAAAAACGTCGCGATAAATGCGGGCGGCGACGCAAGTATCGGTGCG
ATGGGCAATATGACAGCGCTGGCCGGAGATAAACTGGGGCTCTTTGCCCGTACGGGCCAGCTGAGCATGAAGGCCAGCGA
AGGTCCGGTGGAAATGCAGGCGCAGAATGCGGCTATGCGGCTGTTTGCGGAGAAGAAGCTGACGATGAGCTCAGCGAGTG
ACATCTCGTTTGCCGGGAAGAAACGCATCACGCTGGTCGGTGGCGGGAGTTATCTGCGGCTGGAGGCGGGAAAGGTCGAG
TATGGTACGACGGCGTCTTATTTACGCAAAGTGAAGCGGACGATGGCTGCATCAGCCAGTGCTAAACCTGTGCAAGCCGT
ATCCTTGCCGCCTCCGGCGACCATGCGAGAATTCAATCCCGAAACGCTCGCCCCCTGGGTGACGCCGGTGTATGCAAAAT
CCTGCCTGAAGGAGAAAGGCTGCACGGATGCCGGAACTGCCGAAGAGCCCGTTGATAATTTTGGACAGATGACAATTTTT
GCCCAGCCTGTTGAGGACGACTGCTGCGGTTACGGTCATCAGCATGAGCATGCAGATGATGAAGTCGTTCAGCATGCACA
GTCAGCCAAAAAACGTAAGCCTGACGCCGGGGGCGAAAATGCTCCAGCTCAGGCAACGGCTGCCCCGCTTGCTCTGGGAG
CTGCTACTGGCTTGATGACCCAGGTCTGGGGGGAATGGTCCCTGACCGGCGCATTGGGCGCGGCCCGGGGAATTCCGTAT
GTAGGCGCGATGATGTCCGCGCTCTACGTTCCTTCTGCGGGTGAGGGGAGTGACAGGGTTCCTGGGCGAGACGAGTTCTG
GTACGAGGAGGAACTGCGGCAGAAATCCCTCACCGGAGCAAAAGCGACAACCCGGGTGAGATTCTTCTGGCGACAGGATG
AGCAGGGCAACATGCGGGTCTACGGCGTTCATACGGGGGAAGGCACCCCGTATGAAGGTGTGCGCACGGCTGAAATGAAG
TGGGTTGAAAAAAATAGCCGCTATGAGTTCAAACCAGCTCACGGAGCTGATGTTCCTCTGATTACCTGGACGCCCGAACG
ACCGGAGGGCGGCGATTTACCCGCTCATACAGGAAGCGACATAAAACCCATCGACCAGGCTACGATACTCGTCACGCCAA
TACCAGACGGAAAAGATGAATACACGACGCCGCCATTCCCGATGCCGGAAGAGCGGGATCTTAACGATTACATTCTGGTG
TTCCCTGCCGGTTCCGGGATTAAGCCGGTTTATGTTTATCTGAAAGATGATTCACGAAATCAACCCGGAACAGCTACTGG
CAACGGTGTAAAACTATCCGGAGATAAACCCTGGCTAGATTTATCCGTAACAAACAAGGGAAATGGAGCCCCAATTCCAA
GTCATATTGCTGATAAGTTAAGAGGTAGAAGTTATGGATCTTTTGACGATCTAAGAGAAGATTTATGGGAAGAGATAAGT
AATGACCCAAAACTTATGGCTCAGTTTGGTGAAGATAACCAAGAACGTATTAGTAATGGGCTAGCACCTTGGGTTCCATC
AGATGGATACTATCATGGGCCAAATGAGGTTGTTAAAAAATTTCAGATACATCATGATCAAGCGATTGAAGATGGCGGTG
GTGTTTATGATTTAGATAATCTAAGAATCGTCACCCCTCGGTTACATGATGAGATTCACTATAGGAGGTAA